KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g114299Help
Entry
NEMVE_v1g114299   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nve00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:nve04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 665 aa AA seqDB search
ETLGDLAKKYSLDTCISVKFGADRSLDLVAKSVETANLWLVGLQTLINNQSKCTWLIDAF
EKFDKNKDGELGLSEVTKLLNALNVNITPKTIKKRFRVSEQAGAEAALNKEEFAEFFKAI
ATRDEIVEIMNKFTSGKAHMNVEDLQKFLYKQGVKEVSKQYCDIIISTYEPTEEGQRDKQ
LGIDGLTNYLLSKEGDIFDTAHDKVYQDMRQPLSHYFIASSHNTYLMEDQLKGPSSVDAY
INAFNKGCRCVELDCWDGDNGDPIVYHGHTLTSKIKFKDIIQAVAEHAFKVSDYPVILSL
ENHCNIENQRKIAEHLENILGDKLFKDPVDTALTSLPSPESLKGKVLIKGKKLKPEQEMA
AVGEDDGTVSDEDEAADIEQEDLAAAREGEESKEKKVKLAKELSRCVNYISSVGFKNFEH
SKENAKFYQMSSFVESKVATLAQNKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNV
GCQIVALNYQTDGEYMHLNQGRFRENKRAGYVLKPAYMRNPDIKFNPNNPKSCPGVKKKL
LIIQVISGQQLPKPQGSSSKGEVIDPYVEVKIYGVNSDSADFKTKVIKDNGFNPVWNEEI
KKLLYVPELAMLRFCVYDEDVGKDDFIGQFSLPITSLRTGYRHIHLLDIKGEPLPHASLF
VHVML
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gaaacgcttggtgacctcgccaagaagtattcgctggatacgtgcatttccgtcaaattc
ggcgcagatcgcagcctcgatctcgtggccaagtcagtagaaacagctaacctctggctg
gtgggactgcagactcttattaacaatcagagtaagtgcacgtggctgatcgacgccttt
gaaaaatttgataagaacaaagatggtgagctcggcctgagcgaggttacgaaattactc
aacgcgttgaatgtcaacatcacgccaaagacaataaagaagagatttagggtaagtgaa
caggccggtgcggaagctgccttgaacaaagaagaattcgccgagttcttcaaagccata
gctaccagagacgaaattgtcgagatcatgaacaaattcaccagcggaaaagcgcacatg
aacgtggaggatcttcaaaagttcctttataaacagggggtcaaagaagtgtcgaaacaa
tattgtgacattatcatatctacctacgaaccgaccgaagaaggtcaaagggacaaacag
cttgggattgacggactgacgaactacctactgtcgaaagagggagacattttcgatact
gctcatgacaaggtataccaggacatgaggcagccgctctcacactatttcatcgcgtcc
tctcataacacatacctcatggaggaccagcttaaagggccgtccagcgtcgacgcctac
atcaacgctttcaacaaaggctgcaggtgtgtagagctggactgctgggacggggataat
ggtgacccaatcgtttaccacggccacaccctcacctccaagatcaagttcaaagacatt
atacaagctgtagccgaacatgccttcaaagtatctgattaccctgtgattttgtctctg
gagaaccattgcaacattgaaaaccagaggaagatagcggaacatttggaaaacatcttg
ggagacaagctgtttaaagacccagtggacactgcgctgacgagcctcccctccccagaa
tcacttaagggaaaagtcctaatcaaggggaagaagctgaaaccggagcaggagatggca
gcggtcggggaggatgacgggacggtttcggacgaggatgaagctgctgacatcgaacag
gaggatttggcggctgcaagggaaggggaagaatccaaggaaaagaaagtcaagttggcg
aaagagctctcaagatgcgtcaactatatcagtagtgttggattcaagaatttcgaacat
tccaaggaaaatgccaagttttaccagatgtcttcgtttgtcgagtccaaagtcgccact
ctcgcgcagaacaaggccgcgggttttgtggagtacaatacaagacaactgtcccgcaca
tatcccgcgggtagtcgggtagactcgagtaactataaccctcaggtcgcgtggaatgtt
ggctgtcagattgttgcgttgaattatcaaacggacggggagtacatgcacctgaatcag
ggccgctttcgtgagaacaagcgagcaggctacgtcctgaagccagcatacatgcgaaat
cccgatataaaattcaaccccaacaatccgaagagctgccctggggtcaagaaaaagctg
ctcattattcaagtcattagcggtcagcagttacccaaaccacagggttccagctcaaaa
ggcgaggttatcgatccttatgtcgaggtgaagatatatggcgtgaacagcgacagtgcc
gatttcaaaacaaaagttattaaagacaacggttttaaccctgtatggaatgaagagata
aagaagcttctctacgtgccagagttagctatgttgaggttttgtgtatacgatgaagac
gtgggaaaagatgatttcattgggcagttttcccttcctattacaagcctgagaacaggt
taccgacacatccatctgttggacatcaagggcgagcctctgccacacgcctccctgttt
gttcatgtcatgcta

DBGET integrated database retrieval system