KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g115565Help
Entry
NEMVE_v1g115565   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NEMVE_v1g115565
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NEMVE_v1g115565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1126 aa AA seqDB search
MLHVNVFRRLVGFDESEPERQLKEPPAAFLEADAAEVDFSEPRLPPEVIYMLKSVRVFGH
FEKPLFFELVKYIETKFVPANALLFRQGHVDDSIYVVQSGKLRVSLVEKDGTELPMKDVS
QGDSLHSVLSILDLLTGHPMPVPQIRARALVDTHVLRLPGKAFQEVFEQNPESLVRVVQI
IILRLQQVTFTALHGFLGLSYELISSVSISRDLLEGLLAAATRLRTCRAGPPHATLPRTP
RTLKVFKKSSAIFVVVCRTLFPRNCLRPSGNQLDGDVSERGENEPQAIQQTILQCSHAGS
YRSPNDFDAACGRARVVTLGEPSGASRSATFECGSDSEPSPTSLDARFDFATGGLSMEVD
EDDELLQTATREIAKKLEIPSLESRVNIAVIPSGTFLIHQGDHDVNLHFVLTGALEVTQR
SMSEAKDRYDDVLYTAVPGEFLGEMAVITGEPSFFSAKAINQCHVAIITKTIFYSIMRER
PRVILNVACSLVQHLSPFLRQIDYALDWMHIEAGRAVYRQGEQSNCIFIVLNGRLRSVVT
LEDGKKELVSEAGRRELIGLVEVLTQSPRATTVHAIRDTEIAVIPDGLLNTIKRYFPQVV
SRLIHLLGERLLGQYRRGVGQNHRPVDNQIFGGSNLGTVAVIPASTSVPLSNFSFEVSLA
LQAIGPTLLLTSNFVRNTLGSSALDSINEYRLASWLGQQEDLHRMVLYQADTYMSAWTKR
CIRQADCILIVGSADEDPAVGQLELQLEGLQVRAQKELILLHRTVDSSHRISGTVHWLNA
RGWISAHHHVRCPKKIFSKREVCNLLCFHSTLYSYPGGLSSDFARLARRLTGTSIGLVLG
GGGARGLSHVGVIKTLEENGIPVDMVAGTSMGAFVGAAFAEYGDVTKMTQKVREWSWDMN
SMFTKILDLTYPFTSMFSGDGFNASIRSSFGERQIEDLLLPYFCITTDITSSRMRVHTDG
SLWRYVRASMSLSGYLPPLCDPKDGHLLLDGGYVNNLPADVMKKMGAQTIIAIDVGSEYH
GELMNYGDQLSGWWLLWNRWNPFAETVRIPDMAEIQSRLAYVSCVQQLEEVRESSNYEYI
RPPINRFKTLDFGLFDEIVEVGYQHGKTVIGEWTKKSRLQEILQEQ
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgctccacgttaatgtatttcgtaggctggtcggattcgatgagtccgagcctgagcgt
cagctaaaagagccccccgcggcgtttttggaggcagatgcggcggaagtggatttcagc
gagccaagacttccgccggaagtcatatacatgctcaaaagcgtcagggtgttcggccac
ttcgagaagccgcttttctttgagctggtcaagtacatcgagactaagtttgtacccgca
aatgcattgctcttcagacagggtcatgttgatgactcgatctatgttgttcagagcggg
aaattacgggtctcgcttgtagaaaaggatggtactgagctgccgatgaaggatgttagc
cagggagacagtctacacagcgtgcttagtatattggacctgctaacgggtcacccaatg
ccagtcccgcagattcgcgccagagcacttgttgacacacacgtactaaggctacccggt
aaagcttttcaggaggtgtttgagcaaaatccagaatcactggttcgtgttgtacagatc
atcattcttcgcctacaacaagtcacattcaccgcgctccatggcttcctgggactcagc
tatgagctcatcagctcggtgagtatctcgagggaccttttagaaggcctattggccgct
gcaactcgcttacgtacatgtcgcgctgggccgccgcatgcgactctacccaggactccg
cgaacgctgaaggtgtttaaaaaaagctctgctatttttgtcgtggtgtgccgtactttg
ttcccccgtaattgcttgaggccgagtggaaatcagctcgatggagacgtaagcgagagg
ggagaaaatgaaccccaagcgatccaacaaaccattttacaatgctctcatgcaggatca
tatcgatcacccaacgactttgacgcggcctgtggccgagcgcgtgtcgtcaccctcgga
gagccatcgggagcgagtcgcagcgcaacgtttgaatgtggtagcgattcggagccgagt
cctacttcgctggatgcacggtttgacttcgccaccggcggactatcaatggaagtggat
gaggatgatgaactactacaaacagcgacgagggagatcgccaagaaactagaaataccg
tcgctcgagagcagggtgaatatcgctgttatcccatccgggacattcctaatccaccaa
ggagatcatgatgtgaacctccattttgtcttgacgggcgcactagaagtgactcagaga
agcatgagtgaggcaaaggataggtatgatgatgtcctgtacacggctgtgccaggggag
tttcttggggagatggcggtgatcacgggcgagccatccttcttctcggccaaagccatc
aaccagtgccacgtggccatcatcaccaagacgatattctacagcattatgcgtgagaga
ccgcgtgtcatcttgaatgttgcatgctccctggtacagcatctctcacccttcctgagg
cagattgactatgcgctcgactggatgcacatcgaggctggcagagctgtctacaggcaa
ggcgagcagtcaaactgcatcttcatcgtgctgaacggccgcttaaggtccgtcgtcacg
ctagaggatggcaagaaggagctggtcagcgaggcgggcagacgagagcttatcggcctg
gtggaagtcttgacccagtcacccagggcaacaacagtacacgctatccgcgacaccgag
atagctgtgattccggacggactgctcaacacaatcaagcgctacttcccccaggtcgtg
tcacgtttgatacacttactcggtgaacgcttactcggccagtacaggcgaggcgtggga
cagaaccaccgccccgtggataaccagatattcggagggtccaacctgggcacggtggcg
gtcataccagcctccacgagcgtgccgctatctaacttcagctttgaggtcagccttgct
ctacaggccataggtcccactcttctcttgactagcaacttcgtccgcaacacacttggc
agttctgctctcgatagtatcaatgagtatcgcctggcgagctggctgggccagcaagag
gatctgcatcgcatggtgctataccaggcagatacctacatgtccgcctggacaaaacgg
tgcatccgacaggcggactgcatcttgatcgtgggctcagctgacgaggatccagctgta
ggtcagctcgagctgcagttggagggcctgcaggtgcgtgcacagaaggaactaattctc
ctccaccgcacggtagacagtagtcaccggatatcgggaaccgtgcactggctcaatgca
cgcggctggatctctgcacaccatcacgtccgttgtccaaaaaagattttcagtaagcgc
gaggtatgtaatttactatgttttcattcaaccttatattcctatcctggaggtttgagt
tctgacttcgcccgtctggcgcgtcgcctgactggtacgtctatcgggctggttctgggc
ggtggaggtgccaggggattatcacatgtgggtgtaatcaagaccctagaagagaatggg
attcctgtggatatggtggccgggaccagtatgggggcctttgtcggagctgcgttcgca
gagtatggggacgtcaccaagatgacgcagaaggtccgcgagtggtcatgggacatgaac
tcaatgttcaccaagattctcgacctgacctatcccttcacttccatgttctcgggtgat
ggctttaatgccagcatccgcagctcatttggagagcgtcaaatcgaggatctgttactc
ccctatttctgtataactacagatatcacctcgtcgcgcatgcgtgtgcacacagacgga
tccctgtggcggtatgtccgggccagcatgtctctgtccggttatcttcctccgctctgt
gatcctaaagacggccacctcctgctggacggaggctacgtcaataatcttccagcggat
gtgatgaagaagatgggtgcccagacgatcattgcgatcgacgtcggctccgagtatcac
ggcgaactcatgaactatggggaccagctgtcagggtggtggctactctggaaccggtgg
aatcccttcgctgaaaccgtcaggatcccggatatggctgagattcagtcgcggttggcg
tatgtgtcgtgtgtgcaacagttggaagaagttcgagaaagttcgaactacgagtacatc
agaccgcctattaacaggtttaaaactctagacttcggccttttcgacgagatcgtggag
gttggttaccagcacggcaagacagtcatcggggagtggactaagaaatcacgcttacaa
gaaatactgcaagagcag

DBGET integrated database retrieval system