KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g116282Help
Entry
NEMVE_v1g116282   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NEMVE_v1g116282
Enzymes [BR:nve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NEMVE_v1g116282
Transcription factors [BR:nve03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    NEMVE_v1g116282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 463 aa AA seqDB search
QECCMCHKMGATVVCNRVNFYNKVRCSNTYHFGCAIRNNCMFFKDKTMLCHEHRPDGDRE
DRLPSYAVFRKVFIHRDEIEQIARMLRHNQESGGDKLQTLRIGSLVVKSLGQLLLHQLQT
FHTRNAVYPVGFNSIRFYWSMREINKRCQYHCKVEECEGMPLFTLRVNEQGHEDTVFKGK
SPRDVWKQVLEPIHKLRKEAVLVNLWPAYITGEDLFGLTEQFVLRIIESMPGVDYMQGYN
MRYGPSSIMEMPLAINPTGCARAEALIKTHFRSTRSVSSISTAGSNAAGNSSREAEESTS
LYMKQFVYSKASQYRKLKTEWRQNVFLGRSNIQGLGLFANRDMEPGCMVIEYIGSIIRNE
VANKKESIYESQNRGIYMFRIDSDSVIDATIAGGPARYINHSCMPNCVAEVVTFEKEQKI
IIISSRKIEKGEELTYDYKFDFEDDEHKISCLCGAPNCRKWMN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
caggaatgctgtatgtgtcataagatgggtgcgactgtggtctgcaacagagtgaacttc
tacaacaaagtgcgatgctctaacacctatcactttggctgtgccataaggaataactgt
atgttcttcaaggacaagactatgctctgccatgagcatcggcccgatggcgaccgggag
gaccggctgccctcctatgcagttttcagaaaggtgtttattcacagagacgagatcgag
caaatagccagaatgttgcggcacaatcaagagtctggcggcgataaactgcagacgctg
agaataggaagtcttgtggtgaagtctctagggcaacttctgctacatcagctacagacc
ttccacacaagaaatgcagtataccctgttggattcaatagcatccgattctactggagc
atgcgtgaaataaacaaacgttgccagtatcactgcaaggtggaggagtgcgaaggcatg
cccctctttacactacgcgtcaacgagcagggacacgaggacacggtgttcaaggggaaa
tcgcctagagacgtttggaagcaagtgcttgaacctatccataagctacggaaagaagcc
gttctcgtgaacctctggcccgcatacatcacaggggaggacctttttggtttgacggag
cagttcgtactacggatcatcgaatcgatgcctggcgtggattacatgcagggttacaac
atgcgctatggcccctccagtatcatggagatgcccctggcaattaaccccaccgggtgc
gcacgcgcagaggcgctcataaaaacgcacttcagaagcacgaggtcagtatctagcatt
tctaccgctggtagcaatgccgcaggcaatagtagtcgcgaagcggaggaatcgacttcg
ctctacatgaagcagttcgtgtactccaaggcgtcccagtaccgcaagctgaagactgag
tggcgacagaacgtgttccttgggaggtctaacatccaggggcttggtcttttcgccaat
cgtgacatggaaccgggttgtatggtcatcgaatacatcggttctattatccgtaacgag
gtggcgaacaagaaggagagcatttacgagtcacaaaaccgaggaatttacatgtttcgc
atcgactctgactctgtaattgatgcgacgattgccggagggcctgcgcgatatatcaac
cactcgtgcatgcccaactgcgtcgctgaggtggtgacattcgaaaaggagcagaagatc
attattatctcgagccgcaagatcgagaagggggaagagctgacctacgattacaagttt
gactttgaggatgatgaacacaagatctcatgtctgtgcggagctcctaattgccgcaag
tggatgaactag

DBGET integrated database retrieval system