KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g116697Help
Entry
NEMVE_v1g116697   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04068  FoxO signaling pathway
nve04140  Autophagy - animal
nve04150  mTOR signaling pathway
nve04350  TGF-beta signaling pathway
nve04933  AGE-RAGE signaling pathway in diabetic complications
Module
nve_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    NEMVE_v1g116697
   04068 FoxO signaling pathway
    NEMVE_v1g116697
   04150 mTOR signaling pathway
    NEMVE_v1g116697
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    NEMVE_v1g116697
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    NEMVE_v1g116697
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NEMVE_v1g116697
Protein kinases [BR:nve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   NEMVE_v1g116697
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     NEMVE_v1g116697
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g116697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Choline_kinase FTA2 Kdo
Motif
Other DBs
NCBI-GeneID: 5508961
NCBI-ProteinID: XP_001629498
JGI: 116697
UniProt: A7SFQ0
AA seq 347 aa AA seqDB search
MAASTGPEVVRGQVFDVAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKISPFEHQTY
CQRTLREIKILSRFKHENIIGILDIIRAPRAEDMKDIYIVQPLMETDMYKLLKTQRLSND
HICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFL
TEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVL
GSPIADDLLCIKNEKARSYLQSLPYKPKTPFIKLFSNADAKALDLIENLLAFNPNKRITV
EEALAHPYLEQYYDPADEPVAETPFKFQMELDDLPKEKLKGKLNTKF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcggctagcacaggaccggaggtcgttcgcggccaagttttcgatgttgcaccacga
tatacaaatttgaactacatcggagaaggagcgtatggaatggttgtggctggtgttgat
aatacgaccggagagagaatcgctatcaagaagattagcccttttgagcaccaaacatac
tgccaaaggactctcagagaaatcaagattttgagcagatttaagcatgaaaacattata
ggaatactggacatcatacgagccccgagagccgaggatatgaaagatatttatatcgtc
cagccattgatggaaactgacatgtacaaactgctgaagacccagaggctgagcaatgac
catatttgctacttcctctaccaaatactgcgtgggctgaagtatatccactccgctaat
gttcttcacagggacctgaaacctagcaatctgttgctgaacactacttgtgatctcaag
atttgtgactttggtttggcacgcattgctgacccagaccatgatcatactggttttttg
acggagtatgtggcaactagatggtacagggcaccagaaatcatgctaaactccaaaggt
tatagcaaggctattgacatctggtcagtgggctgtattctggcggagatgctagccaac
agacctctatttcctggaaaacattatcttgaccagttaaaccttatccttaatgttctt
ggctcgcccattgcagatgatctgctatgcataaagaatgaaaaagctcgtagctacctg
cagtcgctcccgtacaaacccaagacgccttttatcaaacttttctcaaatgcagatgcc
aaagctcttgacctcatagagaacttgctagcatttaaccccaacaagagaattacagtt
gaagaggctcttgcgcacccataccttgagcagtattatgatcctgctgatgagccagtg
gcagagactcccttcaagttccaaatggagctggatgacttacccaaagaaaagctaaaa
ggtaaactaaatacaaaattctga

DBGET integrated database retrieval system