KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g117537Help
Entry
NEMVE_v1g117537   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NEMVE_v1g117537
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g117537
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NEMVE_v1g117537
Enzymes [BR:nve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     NEMVE_v1g117537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 371 aa AA seqDB search
EDRLRQVLEPHYIQLLSHISRLEGGVKFIVDMRSDLQDGLTSETQLTARQELQALSTSIK
HLLAQWFSVGLLDLQRVTWNSPCSISEKVIRYEAVHPIQGWDDLKRRLAPDRRCYIFTHR
SMPQEPIVVLHTALEYEISDNIQSILSEPEVDIDDCEYELENRTTAIFYSICSTQKGLAG
VDLGNFLIKHVVRELQHEFPNITQYATLSPIPGFRAWLTLELKDAIENKGTNRHSFETSY
VSLRRRFTVCFMLLLLFQELIERDNWHKDQDIIDCIKAPLMRLGTRYLYEEKRRGFAFDQ
VGATMWRLNWMADTSARGLHNSLGLMVNYKYVLEDVDNNNQQYLLNGTIAASKPFLEILD
SETPGNTARVE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gaggaccgccttcgtcaggtgcttgagccacactacatccagctgctttcccacatcagc
cgacttgagggcggagtcaagtttattgtggacatgcgcagtgacctgcaggatggtctt
acgagcgagactcagctcacagctcgtcaggagctacaggcgctcagcacatcaatcaag
catcttcttgcacagtggttctctgtcggtctgctggaccttcaacgggtcacgtggaat
tcaccctgcagcatctctgaaaaggttatccgttacgaggctgtgcaccctatccagggc
tgggatgacctcaagcggcgtctggcacctgatagaaggtgctacatattcacccaccgc
tcaatgccccaggaacccatagtggtgctgcataccgctctcgagtacgagatatcggat
aacatacagtccattcttagtgaacccgaagttgacatcgatgactgtgaatatgagctc
gaaaacagaaccacagcgattttctactccatatgttcgacacagaaaggcctggcaggg
gtggacttggggaactttctcatcaaacacgtggtccgcgagcttcaacacgagtttcct
aatattacccagtatgcaacgctttcgcctatcccagggttccgtgcgtggttgactttg
gagctaaaagacgctattgaaaacaaaggtacaaatcgtcattcgtttgaaacttcttat
gtttctttaaggcgtagatttacagtttgttttatgctattgttattgtttcaggagttg
atcgagagagataactggcacaaagaccaagatatcatagactgtatcaaggccccttta
atgaggctgggaacgagatatttgtatgaagaaaaaagaagaggttttgcttttgatcaa
gtcggggccaccatgtggcgtctgaactggatggctgacaccagcgcacggggcctgcac
aactctcttggactaatggtcaactataagtacgttcttgaggacgtggataataacaat
cagcagtacttgctcaacgggactatagccgcgtccaaacccttccttgaaatactggac
tcggagacacctgggaatacagctcgtgtggaatga

DBGET integrated database retrieval system