KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g117546Help
Entry
NEMVE_v1g117546   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NEMVE_v1g117546
Enzymes [BR:nve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NEMVE_v1g117546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 431 aa AA seqDB search
VVCSQALYGPSTDVVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALK
GVVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIVDAAMRAAQE
AVSQRMSGGGRSSSGGGGRRGGSGGNKEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGH
CQRLAPEWAKAATELKGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDY
QGGRTASDIIQYALDKAADSIEPPEVIQAISNEVLKEGCNEHPICVIAFLPHILDSGASG
RNTYLANLKELGEKYKKNRWGWLWSEAAAQPKLEEAVEVGGFGYPAMVAVNIRKKKFAVL
KGSFDRTGIDEFLRTVSVGRGSTATMRGDSLPELSSIEAWDGKDGQLPQEEDIDLSDVDL
DDEDEPKKEEL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gttgtgtgttcacaagctctctacggcccgagcaccgatgttgtcgagttaactgcaaat
aattttaataatcgagttattaatgacgatgcagtgtggatggtggaattctatgcccct
tggtgtggccactgcaaagcgctagcaccagaatggatgaaggcggcaacagcactcaag
ggtgttgtcaaagttggtgctgttgacatggatgtacaccagtctgttggtgggccctat
aacatcagagggtttccaactatcaagatctttggagccaacaaaaactcccctcaagac
tacaatggccagagaacagcccagggtatcgtggatgccgccatgagggccgctcaggag
gcagtgtcgcagagaatgtctgggggtgggcgcagcagctcaggcggtggcggtcgacgt
ggcggcagtggtggcaacaaggaggatgttgttgagcttactgataccaactttgagaag
gaggttctcaacagcaaggatttgtggcttgtggaattctttgctccttggtgtggtcat
tgccagcggctggctcctgaatgggctaaggctgccactgaactaaaaggcaaagtgaaa
gttggtgccttagacgccactgtgcacaccgtaacagctagccgataccaagtacagggt
taccccactatcaaggtatttgccgctggcattaagaactcccacagtgttgaggactac
caaggaggtcgcaccgcatctgacatcatccagtatgccttggacaaggctgcagactcc
atcgaaccaccagaggtcatccaggcgatcagtaatgaggtgttaaaggagggttgtaac
gagcaccccatctgtgtaatcgctttccttccacacatcttggactctggagcttctggg
cgcaacacctacctagccaacctgaaggagctgggagagaagtacaagaagaacaggtgg
ggatggctctggtctgaggctgcggctcaacccaagctggaggaagctgtcgaggtagga
ggcttcgggtaccctgccatggtcgcggtcaacatccgcaagaagaaatttgcagttctg
aaagggtccttcgatcgcacaggcattgatgagttcctcagaacagtgtctgtgggtagg
ggatcaactgcaaccatgaggggcgactcacttcctgagctatcctctattgaggcatgg
gacggcaaggatggacagctcccacaggaggaggacattgatttatcagacgttgacttg
gatgacgaggacgagcccaagaaagaggaattataa

DBGET integrated database retrieval system