KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g118107Help
Entry
NEMVE_v1g118107   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     NEMVE_v1g118107
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [Table]
   NEMVE_v1g118107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 617 aa AA seqDB search
IENGAKKKVEKRPRFSHQSSWKDAVKKAWSMTDPWAKFHIHDNCAMEIAVRHRYNAIKKS
WVKDEIRIKMESVPFDQGAMRVCYRLKKLSNFSKHNNWKHASNYVAKSYIEEVSRDQYFE
DVRLQMDAKLWGEEYNRRDPPKKVDIFQTYIIELKERTGSPLYHLEHFIEGTYKKYNSNS
GFVLRDETLRCTPQAFSHFTFERSGHQLIVVDIQAINMNSSPKQPRHLRVSISLAINMNS
SPKQPRHLRLLPLTKTRLCHSRICKTLGLTEFDISAVEDKRIDSAIQVIQDSSTVVKSSL
EDQLSPRKMSAIFDLSEYCLGQSPPPSPGATEVSPRSSVSSCNGNPSMSDSETSETESDT
DVFLSNISSEDDDDVKQNYLSVHVHKASSVFAESEQLAQAREQQKEKLLRQKSVSVLGKV
HLEMAKYGEIGRFTSDREPDMESAMFHMEKAAQCGITTALVTLAEIYLQLPHDLMESATV
QETEENTNKGVELMLQAAERGDRQAMLYMAKAYDTGYGLGTNMKRSWKEAVKWYQNAIDV
IDEDDLPENTLLDDPVHTLLSRQAELYFTGGPELERDPQCAGDLFSSAGDEAMAAMKGKL
ANKYYTKAEEAWAEVEE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
attgaaaatggggcgaagaaaaaagttgagaagcgcccaaggttttctcatcagagtagc
tggaaggatgcagttaagaaggcctggtccatgacagatccctgggccaagttccatata
cacgataactgcgccatggagatagcagtgagacatagatacaatgccatcaaaaagtct
tgggtcaaggatgagatccggatcaaaatggaatctgtgccatttgaccaaggagcaatg
agggtctgctacagattgaaaaagttgtcaaacttttcaaaacacaataactggaaacat
gcatccaattatgtggccaagagttacattgaagaggtgtctagagaccagtactttgaa
gatgtcagacttcagatggatgcaaaactttggggagaagagtataatcgtagagaccct
cccaaaaaggtggatatattccagacatatatcattgagttgaaggagcgtaccggttcc
ccactttaccaccttgagcacttcatagagggcacctacaagaagtacaactcaaactct
ggatttgtgctccgtgacgaaaccctaagatgcactccacaggcatttagtcactttacg
tttgagaggtctggccatcagttgattgtggtggacattcaggccattaacatgaactca
tcaccaaagcaacctcgccacctcagggtaagcataagcttagccattaacatgaactca
tcaccaaagcaacctcgccacctcaggttgttgcctttgactaaaacccggctttgtcac
tccaggatttgtaaaacacttggattgacggagtttgatattagtgctgtagaagacaag
cgcatagacagcgctatccaagtaattcaggactcctccactgttgtcaaatcgagcttg
gaagaccagctctctccccgaaagatgtctgctatctttgacttgtcagagtattgcctg
gggcagtctccccctccctcccctggagcgactgaagtgtccccccggagctcagtgtct
tcttgcaatggtaacccaagcatgtcggattctgagacatcggagacagaaagtgacaca
gatgtctttttgtccaatatatcaagcgaggacgacgatgacgtcaaacagaattacctg
tccgtgcatgtgcacaaggcgtctagtgtgtttgctgagtcggaacagttggcacaggcg
cgtgaacagcagaaggaaaagctcctgaggcaaaaaagtgtctctgtcctgggcaaggtt
catcttgagatggcaaagtatggtgagatcggccgcttcacgagcgaccgtgagcccgac
atggagtctgctatgttccacatggagaaagccgctcagtgtggtatcaccacagcgcta
gtcacactagcagagatctacttacagctaccacatgacctcatggaaagcgctaccgtc
caggagacagaggagaataccaataaaggggtggaattgatgctgcaggcggccgagagg
ggggatcgtcaggcaatgttgtacatggctaaggcgtacgacacaggctatggcctgggg
accaacatgaagcgttcgtggaaggaagcagtgaaatggtatcaaaacgcgatcgatgtg
atcgacgaggatgacttgccagagaacacgctactcgatgacccagtacacaccctgttg
tcccgccaggcggagctctactttacaggcggccctgagctggaaagggacccacaatgc
gcaggggatttgttctctagtgcaggagacgaggcgatggccgccatgaaaggcaaactc
gcaaataaatactacaccaaggccgaggaggcctgggcggaagttgaggagtaa

DBGET integrated database retrieval system