KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g119462Help
Entry
NEMVE_v1g119462   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05635  
laminin, gamma 1
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    NEMVE_v1g119462
Cell adhesion molecules and their ligands [BR:nve04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      NEMVE_v1g119462
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      NEMVE_v1g119462
     Laminin-2 Extracellular matrix (ECM) components
      NEMVE_v1g119462
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      NEMVE_v1g119462
   VLA-3
      NEMVE_v1g119462
     Laminin-10 Extracellular matrix (ECM) components
      NEMVE_v1g119462
     Laminin-11 Extracellular matrix (ECM) components
      NEMVE_v1g119462
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      NEMVE_v1g119462
     Laminin-8 Extracellular matrix (ECM) components
      NEMVE_v1g119462
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      NEMVE_v1g119462
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      NEMVE_v1g119462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1586 aa AA seqDB search
LLALLGALTPHSSVGQLQIQCYDSQGRAQRCMPQFGNAAFGKRVISNNTCGDPPKKFCVQ
TGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENPDKPVTLTLDLGK
SYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGVTTNGIVDPRNQQV
ALCTDAFSTITPLTGGNVAFSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRRMNTFGDE
VFGDPNVLRSYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCER
CKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPN
CERCKENFYRKTSLEPCVACGCNPVGSVSLQCNSEGQCRCKPGVTGIKCDKCQANYFGFS
QTGCRPCQCFGPGTDPAKTQCNEKGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCF
CYGHSTVCKAAPGYTSRNITTDFTTGLEGWAVENDQGDSAGFVSVTAIGKESLFARASLV
YIGNRRSSYGQTFGFMFRVGTVDGMQVDNGDITIEGEGGLKITTQLTAQGNPKPGVAFQQ
YRYRLHEDASFGWRPSLTSHDFQRLLTSIKSIKIRMNYADQGTGMLDGMFFESAVYDPTS
PNQVNWVEQCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDTCDPVTGKC
NCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPCKFGTRCIQIGANVVCTDCPEGHVGN
LCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPIS
QCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGD
KCDTCRPEYWNVASGKGCEPCNCDTTGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYA
FSELGCLACNCNLQGSLNVTCDEQGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPCYD
VIQKIVGGLRRKLYDLIYIIDRFNTSSSVVVDVDFEKRLALLKEQVERLLGQSRRSQQYR
QSLNDRVTATRNKVIEIWKNTQAAGNASRAGMSDAMMAHDSLNVSRHLLDLMKSLLMSDA
ARSLNESRLFANSTGEWRMREIAEETKKLADKHENQADEITQKAVQAANASEQAVKTVDK
AVEAQNQTSIDLAELRRMLGEVEQLHVTTRANASKARDRAQNAMRDADELYKNGTAPLPD
LGIDAIRAKANETKAKASEKAMEAMKILSDLKGLVTSFDAKEADVRKKMAEWPGLMDQLE
KLLAAIDNANATAWDAFIKGEDTLQKAKEMLETMQKFNEIIENSRKEAEKAEQNIPEIER
LIASANAKSDNATASLGDAQQVAGEAKDKAGQAQKTADAARMKAEKIRIEAQNLTLPTDT
VSTPAKRAADKLQELKDRVGRERDAIAAAKEKSTNATAASKRARDKIDEVLRKLNELLKE
IDNLDMVDMNKLDELEKKLDNEIESERKVDGALANVEDTHRIIRERITEYTVDLERLKKQ
MAQVQNVINSMPDTCKKRITKSEGRG
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
ctactcgctctccttggcgctcttaccccacacagttctgtcggacaactgcagattcaa
tgttatgatagccagggccgggctcagcgatgtatgcctcagttcggtaacgccgcgttc
ggtaagcgggtcatatctaataatacttgtggggacccgccgaagaagttctgcgtacag
acgggagtattagaggtccgcaaggagtgtgagatgtgcaactcatcggaccccgcgtta
gagcacccggcgctgaaaatcacggacatcaaggacgatacgaatcgtacatggtggcag
tctgagactctgcttgagaaccccgacaaacccgtgacactaactctagacctgggcaaa
tcctacgatgtgtcgtatatacgaatccgattccgatccccgcggcccgagagtatggca
atctacaagaagacgactccatccagtaaatggatcccgtaccagtattttagcgcgact
tgtgagaagacttatggggtcacgaccaacgggattgtagacccgaggaaccaacaagtc
gcattatgcacggacgcgtttagtaccatcacccctctgacaggcggcaacgttgcgttc
agcaccctagaagatcgacccgacgcgtataacttcgacaactctcccgcactgcaagag
tgggtcaccgcggttgccgtgcgaattcatttgcggcgaatgaacacattcggtgatgaa
gtgttcggggatccgaatgttttacggagctactattacgctattattgatctgtctatc
ggagggcgatgcaagtgtaatggccatgcctcggagtgtgaggagacccgcttatgggac
gggcagacccggctccagtgcaaatgtcagcatgacactgaaggggttgactgtgagagg
tgcaagcccctctacaatgacagaccatgggcgcgagcgtcttctaggaatgccaacgaa
tgtgttcgctgtaattgtaacggtctggctgagagctgtgtgtttgacgaggcattgtac
cgacaaacgggacatggcggacgatgccaaaactgcaaacagaacacggacggtccgaac
tgcgagcgatgtaaggagaacttctaccgtaagaccagccttgagccgtgcgtggcgtgt
ggatgcaaccctgttggctcggtctctctgcagtgtaacagtgaaggccagtgcaggtgt
aaaccgggcgttactggaatcaagtgtgacaaatgccaggcgaactacttcggcttctcg
cagactggatgcagaccttgccaatgttttggccccggcactgacccagccaagacccaa
tgtaacgagaaaggtgaatgcacgtgcaagcgtcacgtggtcggtgccaagtgcacgctt
tgccggtcgggatactttggtctggaggcgagcaacccacatggatgcaaacagtgcttt
tgttacggtcactccaccgtctgtaaggccgctcccggctacacgtcacgtaacatcacc
acggatttcaccacaggtctggagggatgggccgtggaaaacgatcaaggtgactccgca
gggtttgtcagcgtaaccgccatcgggaaagagtcgctgttcgctcgggcctcgcttgtg
tacatcggcaaccgacgaagcagctacggacagacgttcggttttatgttccgtgttggt
accgtggacggtatgcaggttgacaatggcgacatcacaatcgaaggcgaaggcggactc
aagatcaccacccaactcaccgcacagggtaaccccaaaccgggcgtggcctttcagcag
taccgctaccgcctgcacgaggacgcctccttcgggtggcgtcccagcctgacgtcacat
gactttcagcgccttctcaccagcatcaagtccatcaagatccgaatgaactacgcggat
cagggaaccggaatgctggacggaatgttttttgaatcggcagtgtacgatccaacatct
ccaaaccaggtgaactgggtggagcagtgcagctgccccaaggagtacaagggaaacaac
tgcgaacagtgtaaagacggctacacgcgacaggcgggctctactgacagatatgcacag
tgcgtgccttgccagtgttacggccattccgacacgtgtgaccctgtcaccggaaaatgc
aactgtaaacacaacaccacaggcatccgctgtgacaaatgcattgacggttactatggc
aaccctactcaggggacccctgacgattgtaagaagtgcccttgcaagttcggcacgcgg
tgcattcagatcggcgctaacgtggtgtgcacggactgccccgagggtcacgtgggcaac
ttgtgtgacatgtgtcaagacggttactatggcgacccaatgggaaagcgtggcgcaccg
accacttgtcagaaatgcaactgtagcggtaacatcgaccctaacgccattgggtcatgt
gaccgcctcactggggactgcctcaagtgcattcacaacacgcgcaacggacccatcagc
cagtgcgagctatgcgctatcggttactatggaaacgccactcactatcctaagccacag
tgcaaagcgtgcgagtgttacgtacagggtactgtttctcctcccggacacgaccccacc
ctccccttcccctgtgacgacaaggggcgctgtacatgtctgccgaacgtcagcggggac
aagtgcgacacatgcagacctgagtactggaacgtcgcctctggcaagggatgtgagcct
tgtaactgcgatacaacaggatcatggaataacacgtgtagcgtgaccacaggacagtgc
cactgcaagcctggcgtgacaggcagacggtgtgaccagtgtagcatcgaccactacgca
ttctctgagctgggatgccttgcgtgtaactgtaacctgcaaggctcattaaatgttacg
tgtgatgagcagggtgtgtgtcagtgccgaccgggagtcctggggatcaagtgcgactcg
tgccaagagaacttccacaacttgactgccgggtgtatagcttgtcccccatgctatgat
gtcattcaaaagatcgttgggggtttacggcggaagctgtacgacctaatatacataatc
gatcggttcaacacctcgtccagtgtagtggtggacgtagactttgagaagagactggca
ctactgaaagaacaagtggagagactgctcggccaaagcagaagaagccaacagtacaga
caaagtctgaacgatcgcgtgaccgccactcgcaacaaagtgattgaaatctggaaaaat
acacaagccgctggcaacgcatcgcgggcgggtatgagtgacgccatgatggcccatgat
tcgctgaatgtctcgcgtcatctgctagacctaatgaagagtctgctgatgagcgacgcg
gcgagatccttgaatgagtcgagactctttgcaaatagcacgggagaatggcgcatgcgt
gaaattgccgaagagacaaagaaacttgccgacaaacacgagaatcaagcagacgaaatt
acccagaaggcagtgcaagctgcgaacgcttccgagcaggcggtgaagaccgtggacaag
gctgttgaagctcagaaccagacctccatcgatctggccgagctgcggagaatgctggga
gaagtcgaacagctgcacgtcaccacaagggcaaacgccagcaaagcacgtgaccgggcc
cagaatgctatgcgcgacgcggatgaactgtataagaatggcaccgcgcctttgccagac
ctgggtattgacgctattagagccaaagcaaacgaaacgaaagcaaaggcttccgagaaa
gccatggaggccatgaaaatcctgtcggatctgaaaggactggtgacgagctttgacgcc
aaggaagcggacgtgcgtaagaaaatggcggaatggcctggactaatggaccagctggag
aagctcctggcggccattgacaatgcaaacgcgactgcgtgggatgcgtttattaaggga
gaggacactctacagaaagccaaggaaatgctcgaaaccatgcagaaatttaacgaaatc
atcgagaattctcgcaaggaggcggagaaagccgaacagaacatccccgaaatcgagcgg
ttgatcgcgtccgcgaacgcgaagtcagataatgcgaccgcgtctctaggggacgcgcaa
caggtcgcgggcgaagccaaggacaaggccggccaggcgcaaaaaaccgcagacgccgcg
agaatgaaagccgagaagattcgaatcgaggcgcagaatctcactctgcctacagacacc
gtcagtacgcccgcaaaacgagcagcggacaaactacaggagcttaaggacagagtcggg
agagagcgagacgcgatcgctgccgcgaaggaaaaatccaccaacgctacggcggccagc
aaacgcgcgagggacaagatagatgaggtccttcgcaagctgaacgagctgctgaaagaa
atcgacaacctcgatatggtggacatgaacaagttggacgaactcgagaagaagctggac
aacgagatcgagagcgagcgcaaggtggacggggcactggcgaacgtggaagacacgcac
cggataatccgcgagaggatcacggaatacacggtggacttagagagactgaagaagcag
atggcgcaagtccagaacgtgattaattctatgccagatacatgcaagaaacgaattacc
aagtcagaggggcgaggctaa

DBGET integrated database retrieval system