KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g119462Help
Entry
NEMVE_v1g119462   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K05635  laminin, gamma 1
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    NEMVE_v1g119462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF Laminin_B F5_F8_type_C V-SNARE_C DASH_Duo1
Motif
Other DBs
NCBI-GeneID: 5507974
NCBI-ProteinID: XP_001628586
JGI: 119462
UniProt: A7SIF3
AA seq 1586 aa AA seqDB search
LLALLGALTPHSSVGQLQIQCYDSQGRAQRCMPQFGNAAFGKRVISNNTCGDPPKKFCVQ
TGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENPDKPVTLTLDLGK
SYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGVTTNGIVDPRNQQV
ALCTDAFSTITPLTGGNVAFSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRRMNTFGDE
VFGDPNVLRSYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCER
CKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPN
CERCKENFYRKTSLEPCVACGCNPVGSVSLQCNSEGQCRCKPGVTGIKCDKCQANYFGFS
QTGCRPCQCFGPGTDPAKTQCNEKGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCF
CYGHSTVCKAAPGYTSRNITTDFTTGLEGWAVENDQGDSAGFVSVTAIGKESLFARASLV
YIGNRRSSYGQTFGFMFRVGTVDGMQVDNGDITIEGEGGLKITTQLTAQGNPKPGVAFQQ
YRYRLHEDASFGWRPSLTSHDFQRLLTSIKSIKIRMNYADQGTGMLDGMFFESAVYDPTS
PNQVNWVEQCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDTCDPVTGKC
NCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPCKFGTRCIQIGANVVCTDCPEGHVGN
LCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPIS
QCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGD
KCDTCRPEYWNVASGKGCEPCNCDTTGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYA
FSELGCLACNCNLQGSLNVTCDEQGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPCYD
VIQKIVGGLRRKLYDLIYIIDRFNTSSSVVVDVDFEKRLALLKEQVERLLGQSRRSQQYR
QSLNDRVTATRNKVIEIWKNTQAAGNASRAGMSDAMMAHDSLNVSRHLLDLMKSLLMSDA
ARSLNESRLFANSTGEWRMREIAEETKKLADKHENQADEITQKAVQAANASEQAVKTVDK
AVEAQNQTSIDLAELRRMLGEVEQLHVTTRANASKARDRAQNAMRDADELYKNGTAPLPD
LGIDAIRAKANETKAKASEKAMEAMKILSDLKGLVTSFDAKEADVRKKMAEWPGLMDQLE
KLLAAIDNANATAWDAFIKGEDTLQKAKEMLETMQKFNEIIENSRKEAEKAEQNIPEIER
LIASANAKSDNATASLGDAQQVAGEAKDKAGQAQKTADAARMKAEKIRIEAQNLTLPTDT
VSTPAKRAADKLQELKDRVGRERDAIAAAKEKSTNATAASKRARDKIDEVLRKLNELLKE
IDNLDMVDMNKLDELEKKLDNEIESERKVDGALANVEDTHRIIRERITEYTVDLERLKKQ
MAQVQNVINSMPDTCKKRITKSEGRG
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
ctactcgctctccttggcgctcttaccccacacagttctgtcggacaactgcagattcaa
tgttatgatagccagggccgggctcagcgatgtatgcctcagttcggtaacgccgcgttc
ggtaagcgggtcatatctaataatacttgtggggacccgccgaagaagttctgcgtacag
acgggagtattagaggtccgcaaggagtgtgagatgtgcaactcatcggaccccgcgtta
gagcacccggcgctgaaaatcacggacatcaaggacgatacgaatcgtacatggtggcag
tctgagactctgcttgagaaccccgacaaacccgtgacactaactctagacctgggcaaa
tcctacgatgtgtcgtatatacgaatccgattccgatccccgcggcccgagagtatggca
atctacaagaagacgactccatccagtaaatggatcccgtaccagtattttagcgcgact
tgtgagaagacttatggggtcacgaccaacgggattgtagacccgaggaaccaacaagtc
gcattatgcacggacgcgtttagtaccatcacccctctgacaggcggcaacgttgcgttc
agcaccctagaagatcgacccgacgcgtataacttcgacaactctcccgcactgcaagag
tgggtcaccgcggttgccgtgcgaattcatttgcggcgaatgaacacattcggtgatgaa
gtgttcggggatccgaatgttttacggagctactattacgctattattgatctgtctatc
ggagggcgatgcaagtgtaatggccatgcctcggagtgtgaggagacccgcttatgggac
gggcagacccggctccagtgcaaatgtcagcatgacactgaaggggttgactgtgagagg
tgcaagcccctctacaatgacagaccatgggcgcgagcgtcttctaggaatgccaacgaa
tgtgttcgctgtaattgtaacggtctggctgagagctgtgtgtttgacgaggcattgtac
cgacaaacgggacatggcggacgatgccaaaactgcaaacagaacacggacggtccgaac
tgcgagcgatgtaaggagaacttctaccgtaagaccagccttgagccgtgcgtggcgtgt
ggatgcaaccctgttggctcggtctctctgcagtgtaacagtgaaggccagtgcaggtgt
aaaccgggcgttactggaatcaagtgtgacaaatgccaggcgaactacttcggcttctcg
cagactggatgcagaccttgccaatgttttggccccggcactgacccagccaagacccaa
tgtaacgagaaaggtgaatgcacgtgcaagcgtcacgtggtcggtgccaagtgcacgctt
tgccggtcgggatactttggtctggaggcgagcaacccacatggatgcaaacagtgcttt
tgttacggtcactccaccgtctgtaaggccgctcccggctacacgtcacgtaacatcacc
acggatttcaccacaggtctggagggatgggccgtggaaaacgatcaaggtgactccgca
gggtttgtcagcgtaaccgccatcgggaaagagtcgctgttcgctcgggcctcgcttgtg
tacatcggcaaccgacgaagcagctacggacagacgttcggttttatgttccgtgttggt
accgtggacggtatgcaggttgacaatggcgacatcacaatcgaaggcgaaggcggactc
aagatcaccacccaactcaccgcacagggtaaccccaaaccgggcgtggcctttcagcag
taccgctaccgcctgcacgaggacgcctccttcgggtggcgtcccagcctgacgtcacat
gactttcagcgccttctcaccagcatcaagtccatcaagatccgaatgaactacgcggat
cagggaaccggaatgctggacggaatgttttttgaatcggcagtgtacgatccaacatct
ccaaaccaggtgaactgggtggagcagtgcagctgccccaaggagtacaagggaaacaac
tgcgaacagtgtaaagacggctacacgcgacaggcgggctctactgacagatatgcacag
tgcgtgccttgccagtgttacggccattccgacacgtgtgaccctgtcaccggaaaatgc
aactgtaaacacaacaccacaggcatccgctgtgacaaatgcattgacggttactatggc
aaccctactcaggggacccctgacgattgtaagaagtgcccttgcaagttcggcacgcgg
tgcattcagatcggcgctaacgtggtgtgcacggactgccccgagggtcacgtgggcaac
ttgtgtgacatgtgtcaagacggttactatggcgacccaatgggaaagcgtggcgcaccg
accacttgtcagaaatgcaactgtagcggtaacatcgaccctaacgccattgggtcatgt
gaccgcctcactggggactgcctcaagtgcattcacaacacgcgcaacggacccatcagc
cagtgcgagctatgcgctatcggttactatggaaacgccactcactatcctaagccacag
tgcaaagcgtgcgagtgttacgtacagggtactgtttctcctcccggacacgaccccacc
ctccccttcccctgtgacgacaaggggcgctgtacatgtctgccgaacgtcagcggggac
aagtgcgacacatgcagacctgagtactggaacgtcgcctctggcaagggatgtgagcct
tgtaactgcgatacaacaggatcatggaataacacgtgtagcgtgaccacaggacagtgc
cactgcaagcctggcgtgacaggcagacggtgtgaccagtgtagcatcgaccactacgca
ttctctgagctgggatgccttgcgtgtaactgtaacctgcaaggctcattaaatgttacg
tgtgatgagcagggtgtgtgtcagtgccgaccgggagtcctggggatcaagtgcgactcg
tgccaagagaacttccacaacttgactgccgggtgtatagcttgtcccccatgctatgat
gtcattcaaaagatcgttgggggtttacggcggaagctgtacgacctaatatacataatc
gatcggttcaacacctcgtccagtgtagtggtggacgtagactttgagaagagactggca
ctactgaaagaacaagtggagagactgctcggccaaagcagaagaagccaacagtacaga
caaagtctgaacgatcgcgtgaccgccactcgcaacaaagtgattgaaatctggaaaaat
acacaagccgctggcaacgcatcgcgggcgggtatgagtgacgccatgatggcccatgat
tcgctgaatgtctcgcgtcatctgctagacctaatgaagagtctgctgatgagcgacgcg
gcgagatccttgaatgagtcgagactctttgcaaatagcacgggagaatggcgcatgcgt
gaaattgccgaagagacaaagaaacttgccgacaaacacgagaatcaagcagacgaaatt
acccagaaggcagtgcaagctgcgaacgcttccgagcaggcggtgaagaccgtggacaag
gctgttgaagctcagaaccagacctccatcgatctggccgagctgcggagaatgctggga
gaagtcgaacagctgcacgtcaccacaagggcaaacgccagcaaagcacgtgaccgggcc
cagaatgctatgcgcgacgcggatgaactgtataagaatggcaccgcgcctttgccagac
ctgggtattgacgctattagagccaaagcaaacgaaacgaaagcaaaggcttccgagaaa
gccatggaggccatgaaaatcctgtcggatctgaaaggactggtgacgagctttgacgcc
aaggaagcggacgtgcgtaagaaaatggcggaatggcctggactaatggaccagctggag
aagctcctggcggccattgacaatgcaaacgcgactgcgtgggatgcgtttattaaggga
gaggacactctacagaaagccaaggaaatgctcgaaaccatgcagaaatttaacgaaatc
atcgagaattctcgcaaggaggcggagaaagccgaacagaacatccccgaaatcgagcgg
ttgatcgcgtccgcgaacgcgaagtcagataatgcgaccgcgtctctaggggacgcgcaa
caggtcgcgggcgaagccaaggacaaggccggccaggcgcaaaaaaccgcagacgccgcg
agaatgaaagccgagaagattcgaatcgaggcgcagaatctcactctgcctacagacacc
gtcagtacgcccgcaaaacgagcagcggacaaactacaggagcttaaggacagagtcggg
agagagcgagacgcgatcgctgccgcgaaggaaaaatccaccaacgctacggcggccagc
aaacgcgcgagggacaagatagatgaggtccttcgcaagctgaacgagctgctgaaagaa
atcgacaacctcgatatggtggacatgaacaagttggacgaactcgagaagaagctggac
aacgagatcgagagcgagcgcaaggtggacggggcactggcgaacgtggaagacacgcac
cggataatccgcgagaggatcacggaatacacggtggacttagagagactgaagaagcag
atggcgcaagtccagaacgtgattaattctatgccagatacatgcaagaaacgaattacc
aagtcagaggggcgaggctaa

DBGET integrated database retrieval system