KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g122091Help
Entry
NEMVE_v1g122091   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NEMVE_v1g122091
   00053 Ascorbate and aldarate metabolism
    NEMVE_v1g122091
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    NEMVE_v1g122091
   00860 Porphyrin and chlorophyll metabolism
    NEMVE_v1g122091
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    NEMVE_v1g122091
   00982 Drug metabolism - cytochrome P450
    NEMVE_v1g122091
   00983 Drug metabolism - other enzymes
    NEMVE_v1g122091
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     NEMVE_v1g122091
Glycosyltransferases [BR:nve01003]
 Others
  Hydrophobic molecule
   NEMVE_v1g122091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
SDGAKIVGYPMMGGSQYIGMKRIAQELAARGHEVTLLVSSIQKIKPTEGITHAVYQAPVD
KNYMEQMVSHVIQNGVKEIFSKTGLLGVMPSFCEATLNSTDIIDLMKEFDIMISDTSMPC
GPVLAEYLNITRVDYCPGSPRIPLLYQYHAPTFPSYVPLLLAGNPARMNFLQRVKNTLVY
LAGQTMMRLVMFPKYDNIKQRYNINPELSFSESLGRAEMVLFLADHALDYPFPLLPGHKL
IGGINIEPARPLSPEFQHIVNKSDGVIVVSFGSNFAAIADKEVDVLARAFGRLKETVIWR
QKGYIPANLSPNIKTVEWLPQNDLLANEKTRVFVSHLGQNSLYEAGYHGIPLVGVPLFGD
QPDNAVLVEDKGLGLAVDIHTVTADKLYRTIRRVIDEPRFKENAARISRLMQDRRRSPTE
EAADWIEYTLRHKRLTHLRPASVHLTWYQYFLLDVILFMGAVLLSVAMVIRLVFKLVCSC
CRRKQTKTKTQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
agcgatggcgctaagatcgtgggttacccgatgatggggggaagccagtacattgggatg
aagaggatcgcgcaagagttagccgccagaggacatgaggtaaccctgttagtcagctca
atccagaagatcaagccaacagaaggaatcactcatgctgtctaccaagcaccagtggac
aagaactatatggagcagatggtttcccatgtcattcagaatggtgtcaaggaaatattt
agtaaaacagggctgctgggtgtaatgccatcattctgtgaagccacgttgaattctact
gatataatagacctcatgaaagagtttgatattatgatttctgacacgtcgatgccttgt
ggtcccgtgctcgccgaatatttgaacataacaagagtggactactgtcccggctcacca
aggattcccctattataccagtaccatgccccaacttttccatcctacgtccccctatta
ttggcaggaaacccagctagaatgaacttcttacaaagagttaaaaacactttggtttac
ttggctgggcaaacaatgatgagactggtgatgtttccaaagtatgataatattaagcaa
aggtataatatcaatcctgagttgagttttagtgagagtttgggcagagccgagatggta
ttattcctggcagatcatgctctggattatcccttccctttgttaccaggacacaaattg
attggtggtataaacattgagccagcccgacccctttccccagagtttcaacatatagtt
aacaagtcagatggcgtcatcgttgtatcgtttggttcaaattttgccgccattgctgac
aaagaagtcgatgttttggcaagggcgtttggtcgcctcaaagagacagttatttggagg
caaaaagggtacattccggccaatctgagcccaaacatcaaaaccgttgaatggcttcct
cagaatgatctcctggcgaatgagaaaactcgcgtgtttgtgtcacatcttggccagaac
agcttgtatgaggctggctatcacgggattcctttggtgggtgttcccttatttggcgat
caacccgacaacgctgtgcttgtggaggataagggactgggactagcagtcgatatccac
acggtgacggctgataagttgtaccgaacgatacgacgagttatcgacgagcctcgattc
aaagaaaatgcggcgcgtatttcccgcctgatgcaagaccgccgacgctccccgacagag
gaagctgctgattggatagaatacacactacgtcacaaaagattgacacatcttcgcccc
gcctctgtccaccttacttggtaccagtactttcttcttgacgtcatactcttcatgggc
gcggttctgctatctgttgccatggtaatcagacttgtattcaaacttgtctgctcgtgc
tgtcgtcgaaagcaaacgaagacaaagacgcaatag

DBGET integrated database retrieval system