KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g122091Help
Entry
NEMVE_v1g122091   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nve00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:nve00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nve00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:nve00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nve00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:nve00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:nve00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:nve00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
SDGAKIVGYPMMGGSQYIGMKRIAQELAARGHEVTLLVSSIQKIKPTEGITHAVYQAPVD
KNYMEQMVSHVIQNGVKEIFSKTGLLGVMPSFCEATLNSTDIIDLMKEFDIMISDTSMPC
GPVLAEYLNITRVDYCPGSPRIPLLYQYHAPTFPSYVPLLLAGNPARMNFLQRVKNTLVY
LAGQTMMRLVMFPKYDNIKQRYNINPELSFSESLGRAEMVLFLADHALDYPFPLLPGHKL
IGGINIEPARPLSPEFQHIVNKSDGVIVVSFGSNFAAIADKEVDVLARAFGRLKETVIWR
QKGYIPANLSPNIKTVEWLPQNDLLANEKTRVFVSHLGQNSLYEAGYHGIPLVGVPLFGD
QPDNAVLVEDKGLGLAVDIHTVTADKLYRTIRRVIDEPRFKENAARISRLMQDRRRSPTE
EAADWIEYTLRHKRLTHLRPASVHLTWYQYFLLDVILFMGAVLLSVAMVIRLVFKLVCSC
CRRKQTKTKTQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
agcgatggcgctaagatcgtgggttacccgatgatggggggaagccagtacattgggatg
aagaggatcgcgcaagagttagccgccagaggacatgaggtaaccctgttagtcagctca
atccagaagatcaagccaacagaaggaatcactcatgctgtctaccaagcaccagtggac
aagaactatatggagcagatggtttcccatgtcattcagaatggtgtcaaggaaatattt
agtaaaacagggctgctgggtgtaatgccatcattctgtgaagccacgttgaattctact
gatataatagacctcatgaaagagtttgatattatgatttctgacacgtcgatgccttgt
ggtcccgtgctcgccgaatatttgaacataacaagagtggactactgtcccggctcacca
aggattcccctattataccagtaccatgccccaacttttccatcctacgtccccctatta
ttggcaggaaacccagctagaatgaacttcttacaaagagttaaaaacactttggtttac
ttggctgggcaaacaatgatgagactggtgatgtttccaaagtatgataatattaagcaa
aggtataatatcaatcctgagttgagttttagtgagagtttgggcagagccgagatggta
ttattcctggcagatcatgctctggattatcccttccctttgttaccaggacacaaattg
attggtggtataaacattgagccagcccgacccctttccccagagtttcaacatatagtt
aacaagtcagatggcgtcatcgttgtatcgtttggttcaaattttgccgccattgctgac
aaagaagtcgatgttttggcaagggcgtttggtcgcctcaaagagacagttatttggagg
caaaaagggtacattccggccaatctgagcccaaacatcaaaaccgttgaatggcttcct
cagaatgatctcctggcgaatgagaaaactcgcgtgtttgtgtcacatcttggccagaac
agcttgtatgaggctggctatcacgggattcctttggtgggtgttcccttatttggcgat
caacccgacaacgctgtgcttgtggaggataagggactgggactagcagtcgatatccac
acggtgacggctgataagttgtaccgaacgatacgacgagttatcgacgagcctcgattc
aaagaaaatgcggcgcgtatttcccgcctgatgcaagaccgccgacgctccccgacagag
gaagctgctgattggatagaatacacactacgtcacaaaagattgacacatcttcgcccc
gcctctgtccaccttacttggtaccagtactttcttcttgacgtcatactcttcatgggc
gcggttctgctatctgttgccatggtaatcagacttgtattcaaacttgtctgctcgtgc
tgtcgtcgaaagcaaacgaagacaaagacgcaatag

DBGET integrated database retrieval system