KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g124482Help
Entry
NEMVE_v1g124482   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 359 aa AA seqDB search
SSDGLVGLRNLGNTCFMNSILQCLSSTWLLTNIVLKGTYVSSINNKSSMKGRLVQAFADL
IKSMWKHDATESAISAHAFKTQIQRFAPRFVGFNQQDAQEFLHFLLEGLHDDLNKVQEKP
KYKMCEFDNSLSDLEKAKKAWKLYIERDNSLITDLFVGVLKSTLICLECGFKSVTFDPFW
DLSLPIPRKSGSRYSSSRYTDGGDVDIRDCMELFTKEEVLDGDERPTCEKCKKKRKSTKK
FTVQRFPRILVIHLKRFSGYGFRSKLQTNVVFPVTSPQELGEFAADPSEGQSAVYSLYAV
SNHSGSTYGGHYTAYCKHPQSRQWHCFNDSRVDQISSSRVTGPQAYILFFEKHDRKSSL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
agcagcgatggtttggttggtcttcgtaatcttggaaatacatgttttatgaactctatc
ctacaatgtcttagcagcacatggctgctcacgaatattgttctgaaaggaacttatgtc
agcagcatcaacaataaaagcagtatgaaaggtcgccttgtacaagcttttgctgattta
attaaatccatgtggaagcatgatgcgacagagtctgctatctcggcccatgctttcaag
acacagatccagagatttgccccacgctttgtaggattcaatcagcaagatgcacaagag
ttcttacactttctacttgaaggcctccatgatgatctgaataaagtacaagaaaagcca
aagtacaagatgtgtgaatttgacaactctctctctgatttggagaaagcaaagaaggca
tggaagctttacattgagcgagataacagcttaattacagacctgtttgtgggcgtactc
aagagcacccttatatgcctagaatgcggcttcaagtcagtcacctttgatcctttctgg
gatctctcccttcctataccaaggaaatctggtagtaggtactcaagtagccggtatact
gatggaggcgatgtggacatccgggactgtatggaactcttcaccaaagaggaagtactt
gatggtgacgagagaccgacctgtgagaagtgcaaaaagaagcgcaagtcaaccaagaaa
ttcacagtacagagatttccaagaattcttgttattcacctaaagcgcttctctggttat
ggttttcgatccaagctccagacaaatgttgtgtttcctgttacatccccccaggaactt
ggtgaatttgcggctgatccatcagagggccagtctgctgtgtacagcctgtacgctgtt
tctaaccactctgggtcaacatatggcggccattacacggcttactgtaagcacccacag
agtagacagtggcactgttttaacgattcaagagttgatcagattagctcatcgcgtgtg
accgggccccaggcctacattctattttttgagaagcatgacagaaaatcatcgttgtaa

DBGET integrated database retrieval system