KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g124883Help
Entry
NEMVE_v1g124883   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    NEMVE_v1g124883
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NEMVE_v1g124883
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g124883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 96 aa AA seqDB search
NIVEEMFQGRLVHETKCLTCENAKQRFEDFQDVSVPKHTLEWAISQFATVEVLKDNNKYF
CENCCTYTEARLSTFFDLLPQVLTLHLKRFTSVYSG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
aacattgttgaagaaatgtttcagggtagacttgttcatgaaacaaagtgtctaacatgt
gaaaacgccaagcagaggtttgaagattttcaagatgtcagtgtccctaaacatacttta
gagtgggctatatcacagtttgctactgtggaggttttaaaggataataacaagtacttc
tgtgagaactgctgcacctacactgaggcaagacttagtacattctttgatctgctacca
caggtgctgactctacatctgaagcgattcacgtcggtctactcggggtaa

DBGET integrated database retrieval system