KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g125608Help
Entry
NEMVE_v1g125608   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K10636  
autocrine motility factor receptor [EC:6.3.2.19]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NEMVE_v1g125608
Enzymes [BR:nve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     NEMVE_v1g125608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 407 aa AA seqDB search
MVYGCLFMFGKVIQRIVFGDLRAAELQQIQDKFWNFVFYKFIFIFGVLNVQKMNEVMWWT
AWFTLLGFFHLFAQLCKDRFEYLSFSPTTTPSTHGKIAGLLVVLLFLCNGLFSLTMFVGW
PHGIHTFTFMLAEVCILYTVLTTSMIYYFIRYGIHLWDIGHVGTWEGRNTWSYYTDLLLD
IGMCSVDFAHHLHMLLWSNIFLSMASLVLCMQLRHLFYEIKKRLARHRNFVRIQKCTETR
FPEATTEELLQNNDDCAICWDNMGKARKLPCNHLFHSSCLRAWLENDTSCPTCRKSLAED
LQPEEEEERSRGMAAFMTGRDIRRNHFHFDGTRIASWFPSFSVEVVHTHTDNMENLQLPE
SRVEAMAHQVHAMFPHVPINIITEDLRQTHSIELTTDNFLEGRLAVP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggtatatggctgcttgttcatgttcggaaaagttatccagagaattgtgtttggggat
cttcgagccgctgaactgcagcaaatccaggacaagttttggaactttgtattctacaag
ttcatctttatctttggcgtgttgaatgtgcagaagatgaacgaggtcatgtggtggacg
gcttggttcaccctgctcgggttcttccacctttttgctcagttgtgcaaagaccggttt
gaatatctgtccttctctcccactaccaccccctcgactcatggcaagatagcgggacta
ctagtggtactactgtttctctgcaatggactcttctctctgacaatgtttgtgggctgg
ccacatgggattcatactttcacctttatgttggcagaggtttgtatactttatactgta
ctcaccacttctatgatatattacttcatcaggtatggtatccacttgtgggacattggc
catgtgggtacttgggaggggcgtaacacctggagctactatactgacctcctcctggat
attggcatgtgtagtgtcgactttgcccaccatctccacatgctgttgtggtccaacatc
ttcctgagtatggccagcctcgtgctgtgtatgcagttgcgccaccttttctacgagatc
aagaagagacttgcaagacacaggaacttcgtgcgtatccagaagtgcactgaaactaga
ttccctgaagctacaacagaagaactgctgcagaacaacgatgactgtgctatctgttgg
gacaacatgggcaaagcacgcaagctcccttgcaaccatctgttccacagctcctgcttg
cgggcgtggttggagaatgacacctcttgcccgacttgccgtaagtcgcttgcagaggac
ctgcaaccagaagaagaagaggagagatcaaggggcatggcggcgttcatgacggggcgg
gacatcagacggaaccatttccatttcgatgggacgcgcatagcaagctggtttcccagt
ttctctgtcgaggtcgtccacacgcacacagataacatggagaacctccagttacctgag
agcagagttgaagcaatggcccatcaagtccatgctatgtttccccatgtccccatcaac
atcattacggaggacctgcgccagactcactccattgagctgaccacggataacttcctc
gaggggcgactagcagtacct

DBGET integrated database retrieval system