KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g127768Help
Entry
NEMVE_v1g127768   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     NEMVE_v1g127768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 353 aa AA seqDB search
VIQKKHKFAFGAAVNSMKLKYKKYREFLLEHFEWGVLESHMKWPLNEPKPGEYHYHYADM
AVAWLERHNISIRGHCIYWSIPDMLPEWLLSLPRGKLMHHVRTRINQIVKRYRGRMLHWD
VINEMLQGSFFADRLGGNKIREWMINRTAELDPKAKLFLNEYEVISEGQLTQPYVELANT
IIRHGSPVDALGVQGHFTGMVNPTLLRLRLDALSEVKRPMWLTEFDILDPNTEQRADSTE
AVMREAFSHPSVEGIIFWVFWDLHSWRGKNAGLVDGYDFKLNAAGRRFVKLMRKWTTKKR
LKPIREDTGSAVATFRGFHGDYDVQVTLPDGQLVRRQFTLEPGNKAFRLDIDI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtcattcaaaagaaacacaagttcgcctttggagccgcagtaaatagtatgaaactaaaa
tataagaaataccgagagttcctcctggagcacttcgaatggggagtgctagagtcgcat
atgaagtggccactcaacgagcctaagccaggagagtatcactatcactacgcggatatg
gctgtagcgtggctagagaggcacaacatttcgatccggggccactgcatctactggtcg
ataccagacatgttgccagagtggctcctctcactacctagaggcaagctgatgcatcac
gtcaggacaaggatcaaccagatcgtgaaacgatatcgtggaaggatgcttcactgggac
gtcattaacgagatgttgcagggctcattcttcgccgatcgactagggggaaacaaaatt
cgggaatggatgattaacaggaccgcggagctggatccgaaagcaaaactattcctcaac
gaatatgaagtcataagcgaaggacagctcacacaaccatatgttgaactggccaatacg
attatcaggcacgggagccctgtagatgctctcggagtccagggtcacttcactggtatg
gtcaaccccactctgctaaggctgcggttagacgctttatccgaagtgaagcgaccgatg
tggctgacagagtttgacattcttgatccgaatactgaacagcgtgcagacagtacagag
gcggtcatgcgagaggcgttcagtcacccgtcagtagaggggatcatcttttgggtcttc
tgggacctgcattcttggagaggcaagaacgcgggcctcgtggatggttatgactttaag
cttaacgcggcaggtcgtaggtttgtcaagcttatgcgcaaatggacaacaaaaaagcgt
ctcaagccaatcagagaggatactggtagtgcagtagctacatttcggggtttccatggt
gactatgacgtacaagtgaccctgcctgatggacagttggtcagaaggcaatttactctg
gagcctgggaacaaggcattccgcctggatatcgatatt

DBGET integrated database retrieval system