KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g131752Help
Entry
NEMVE_v1g131752   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     NEMVE_v1g131752
Peptidases [BR:nve01002]
 Serine Peptidases
  Family S33
   NEMVE_v1g131752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_5 Ndr Esterase DLH Lipase BAAT_C Abhydrolase_3 DUF2048 DUF1057 SoxE Esterase_phd
Motif
Other DBs
NCBI-GeneID: 5503957
NCBI-ProteinID: XP_001624898
JGI: 131752
UniProt: A7SU25
AA seq 282 aa AA seqDB search
MFWAGFSNNTIRIGDFEFSYIERGSEKTTQSTIVLIHGFSSSKDVWCQMSHGLPRSYHLI
ALDLPGHGKTTRKHHDNFSIPSQVSKLHQFLHAVGVNKRKFHLAGISMGGHIVGVYAAQH
PARVASVIMMCPAGIQAPEHSEFITDVVLNGEKNYLIPDTPEDFQKMLNKVLHREVTIPY
FIAKLFADVRRPCKDFYQKVLEDIVHPDHRFLLHHVLDDIHVPSLVLWGVDDKIIHVSSV
HVMKEKMKNCQVQLIERCGHAIFLERPWKTAKLVNEFLSSLH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggcgggattctccaacaacactatcagaattggagactttgagttctcttat
attgaaagaggaagtgagaaaacaacccagtcaacaatagtactcatccatggttttagc
tctagcaaggatgtgtggtgtcaaatgtcacatggcttgcccaggtcataccatcttatt
gcactagacttgcctggacatggtaaaaccaccaggaagcaccatgataatttcagtatc
ccttcacaagtgagcaagctacatcagtttctccatgctgttggcgtcaataagaggaag
tttcatcttgccgggatatcaatgggtggtcatattgtaggtgtttatgctgcacagcac
cctgcaagggttgcatccgttatcatgatgtgtccagcaggtatccaggcccctgagcac
agtgagttcatcacagatgttgtcctcaatggggagaagaactacctaatcccagacaca
ccagaggatttccagaaaatgctgaacaaagttcttcacagggaggtcaccattccatat
tttattgccaagctgtttgctgatgttaggagaccttgtaaggacttttatcagaaagtt
ctagaagacattgtgcacccagatcatagatttcttctccatcatgtgcttgatgacata
catgtaccgtcactggtactctggggggttgatgacaagataatccatgtttccagtgtc
catgtgatgaaagaaaaaatgaagaattgtcaagttcagctgatagaaaggtgtggccac
gctatattccttgagagaccttggaaaactgctaaattagttaatgaattcttgtcgtca
ttgcattag

DBGET integrated database retrieval system