KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g132003Help
Entry
NEMVE_v1g132003   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11855  ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NEMVE_v1g132003
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g132003
Ubiquitin system [BR:nve04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    NEMVE_v1g132003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 CpXC
Motif
Other DBs
NCBI-GeneID: 5503887
NCBI-ProteinID: XP_001624836
JGI: 132003
UniProt: A7SU92
AA seq 406 aa AA seqDB search
GDLDSKLVTSSKQVLLQRIEFKPASKPDEQYEKLKQKYKPLNSGSNYGQIKSNLLTNGKV
DASDSIPSPKFVLYPIDKINTQWTRVRRMGPGLSNLGNTCFLNSVVQVLTYTAPLVNYLA
TQEHTRECQMVGFCMMCELQRHILRTFNHQQNESIKPLCIIQRLRSIAKHLRFGHQEDAH
EFLRYVIDGMQKSCLAGQPEKMDRYSKETTIVHGIFGGYYRSQVQCLKCHNTSNTFDPLM
EIMVDIKHSPSVVRAIQRMCKAELLDGDNLYQCPRCKKKVPAHKQVLIHRPPNILTIQLK
RFDYHHMFGGKVSKEITYTEHLDLRPFMTNPKGPPLKYKLYGVLVHSGYSCNSGHYYCYV
RGSNDCWYNMNDSMVRQVGLNTVLAQQAYLLFYSRVKARQTPEASI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ggcgatttggactccaagcttgtaacttcatccaaacaagtgttactacagaggatagaa
ttcaaaccagcatctaaaccggacgaacaatacgaaaaactaaagcaaaagtataaacct
ttgaattctggatcgaattatggacaaattaaatcgaatttgttaacaaatggaaaggtt
gatgcatctgatagtattccttcacccaagtttgttctgtacccaattgacaagatcaac
actcagtggaccagggtccgacgcatggggccgggcctcagtaaccttggcaacacttgt
tttctgaactctgtggtacaggtgttaacatacactgcacccctagtcaattatctggct
acacaagagcacaccagggaatgtcaaatggttgggttttgcatgatgtgtgagctacaa
cgacacattttgagaaccttcaatcaccagcaaaatgaatcaataaagcctctttgcatc
atacaacggctgaggagtatagcaaagcacttgcgatttggacatcaggaggatgcccat
gagtttctgcgatatgtcattgacggaatgcagaagagttgtcttgcaggacaaccagag
aaaatggatagatactctaaagagacaactattgtccatggaatatttgggggatattac
cgcagtcaagttcagtgcctcaaatgccataacacgtccaacacatttgaccctctgatg
gaaatcatggttgacatcaagcacagtccatcagtggtacgagcaattcagcgaatgtgt
aaggcggagctgcttgacggagacaacctataccagtgcccaaggtgtaaaaagaaagtc
ccagctcacaagcaagttcttattcatcgcccacctaacattctgacaattcaactgaaa
aggtttgactatcatcacatgtttggaggcaaagtttcgaaggaaattacttacacggaa
caccttgatctccgaccctttatgaccaacccaaagggaccccctctgaagtacaagctg
tatggtgtgctggtacattctgggtattcctgcaactcaggccactattactgctatgtg
cgtggctctaacgactgttggtacaacatgaatgattcaatggttcgtcaagttggactc
aatacagtccttgctcagcaagcctacctgttgttttactcaagagtcaaagcacgccaa
acaccagaggcgagtatt

DBGET integrated database retrieval system