KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g134873Help
Entry
NEMVE_v1g134873   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K15293  protein unc-13 A/B/C
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Membrane trafficking [BR:nve04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    NEMVE_v1g134873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1041 C2 C1_1
Motif
Other DBs
NCBI-GeneID: 5503043
NCBI-ProteinID: XP_001624150
JGI: 134873
UniProt: A7SW72
AA seq 666 aa AA seqDB search
MAKRRCPAQLNMDQRANLNDEELKTHVYKKTLQALIYPISDTTPHNFESFSTQVPAYCYE
CEGLLWGLAWQGLKCRDCGVKCHERCKDLLNADCLQRAAEKSVRHGSNDKTQSIIVAMKS
RMEERERLKPEIFQLIREVFRVDPKTHAGYLNNVKTQIWMGTSKWSAKISITVVSAQGLI
AKDKTGTSDPYVTVQVGKTKKRTSTIPHELNPEWNETFLFECHNSSDRIKVRVWDEDDDI
KSRVRQKLIREPDDFLGQTIIEVRTLSGEMDVWYNLEKRTDRSAVSGAIRLRISIEIKGE
EKVVPYHTQYTCLHENIFHFLCQKNGGQFPVPTSTGRDEPWKVFFSEPALEIVNEFAMRY
GIESIYQAMTHFSCLTSCYTHPGIPALISSLFANINAFFSHTTTNSATSATHRFAATNFG
SDKFVKIIDHLHNTLRIDMANYRTNFPSSSPDKLNDLKSSVDILTSITFFRMKVLDQRPT
RTAEVVAECVKNCMRATYAFLFANCVDLYDREIANERSAEDPDQPSGPKNLDFWPKIISL
IVSVIEEDRGIYSQVLNQFPQELNVGEVSAETFWNLFASDLQEMLQDHSTTPEWTSADYM
NLHFKVKWFFNEYAMNTPGNKNMIPRYTGWFEPFVSQWLTENDEVSMEFMIAALERDRKD
GVCLAY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcaggtgtcctgctcaactcaacatggaccagcgggccaacctgaacgat
gaggaactgaaaacccatgtgtacaagaaaacattacaagcattgatatatccgatatca
gacacaactccgcataactttgaaagcttctcgacccaggttcccgcgtactgctacgag
tgcgagggactactgtggggcctggcctggcagggactcaaatgcagagattgcggtgtc
aagtgccacgagagatgcaaagacttactcaacgctgactgcttacaacgcgctgcggag
aagtctgtccggcacggctctaatgataaaacccagagcatcattgtcgccatgaaaagt
cgaatggaagagcgagaacgactcaagccggagatattccagttgatcagggaggttttt
cgagttgaccccaaaacccatgcaggctaccttaacaatgtcaagacccagatatggatg
ggaacctccaagtggtcagcgaaaatcagcatcacagtggtcagtgcgcaagggctgatt
gccaaagataaaacaggcacgagtgacccttacgtcacggtccaagttggcaagacgaaa
aagcgcacaagcaccatcccgcacgaactgaaccctgagtggaacgaaactttcctgttc
gagtgccacaattcatctgatcgtataaaagttcgcgtctgggacgaagatgacgatata
aagtcacgtgttcgtcagaaactgatccgtgaaccggacgattttctcggacagactata
atagaggtccggacacttagtggggaaatggacgtctggtacaatctcgaaaaacgtaca
gacaggtcagcggtctctggtgccatacgcctgcgaatcagcatcgagatcaaaggcgag
gaaaaggtggtcccttatcacacgcagtacacgtgtctccacgagaacatatttcacttt
ttgtgtcaaaagaatggcggccaatttccagtccctacctcaacagggagagacgagccc
tggaaagtgttcttctctgagccagctcttgaaatcgtgaacgagtttgctatgagatac
ggcattgaaagcatctaccaagctatgactcacttttcttgtctcacctcatgctacaca
caccctggtatcccggccctcatcagctctctctttgccaacatcaacgcgttcttctca
catacaaccacaaactccgcaacctccgccactcaccgcttcgccgctacaaactttggg
agcgataaattcgtcaaaataatcgaccatcttcataacactctacgaatcgacatggcc
aactacaggaccaacttcccgtcgtcaagtccagacaagttgaacgacctcaagtcttcc
gtcgatatcctcacaagtatcacatttttccgaatgaaggttctagatcaaaggccaacg
agaacagcagaagttgttgcggaatgtgttaagaactgcatgagggcaacttatgcattc
ctgttcgcaaactgtgtggacttgtacgaccgcgagattgcgaatgagcggtcagcggaa
gaccctgaccaaccatcaggcccgaaaaaccttgacttctggcccaagatcatctctctt
attgtgtcggtgatcgaggaggatcgcgggatatactcacaagtcctcaaccagttccct
caggagctaaatgtcggcgaagtgagcgccgagacattctggaacttgttcgcctcggat
ttacaggaaatgctgcaagatcatagtactacccctgaatggacgagcgcggattacatg
aatcttcacttcaaggtgaagtggttcttcaatgaatatgcgatgaacacaccaggaaat
aagaacatgattcctagatacactgggtggtttgagccgttcgtgtcgcaatggttgacg
gaaaatgacgaggtttccatggagtttatgatagcagcactggaacgagacagaaaggat
ggggtatgtcttgcatactga

DBGET integrated database retrieval system