KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g136346Help
Entry
NEMVE_v1g136346   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NEMVE_v1g136346
  Lipid metabolism
   00062 Fatty acid elongation
    NEMVE_v1g136346
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    NEMVE_v1g136346
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NEMVE_v1g136346
Lipid biosynthesis proteins [BR:nve01004]
 Fatty acid synthase
  Component type
   NEMVE_v1g136346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 273 aa AA seqDB search
YKPVIVLHGILDKASDMKDLAGFIRSAHPGTNITIVDMFSELKSFEPLWRQVRGISPKLR
PIMEQAKDGVHMIGFSQGGITLRGIIETMPDHNVDTFIALSSPLMGQYGDTSYLNPFIPY
KLRKDAYEFFYSRIAQDTLAIANYWNDPYHQKLNMEYNIFLPFINNNQSSAWINETAYKQ
QKANFLKLKNLVLIGGPDDGVITPWQSSHFGFYDQDLNVLDMTQQMVYLDDTFGLQTLDK
RKAVHMYTFPGIEHVKWHGSEQVFDKAIKPWLT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
tacaagccggtaattgtacttcatgggatattggacaaggccagtgatatgaaagatctt
gctggatttatccgatccgctcaccctgggacgaacatcaccattgttgatatgttctct
gaattgaagagctttgaacctctttggagacaagtacgcggtatatctccaaaactgcga
ccaatcatggaacaagcgaaagacggtgttcatatgataggtttttcgcaaggaggtata
acattgcgcgggatcatagagactatgccagatcacaatgtggacacattcattgcactg
tcctctcccctgatgggccagtatggagacaccagctatctgaatccatttatcccttac
aaacttagaaaggatgcatatgaattcttttacagcaggatagcgcaggatacactagcg
attgcaaattattggaatgatccttatcatcagaagttgaatatggagtataacatcttt
ttaccatttataaacaacaatcagtcatcagcatggatcaatgaaactgcatacaagcag
cagaaagcaaactttttaaaactgaagaatcttgttcttattggtggaccagatgatgga
gtaataacaccatggcaatcaagtcactttggattttatgaccaagacttgaatgtcctg
gatatgactcagcaaatggtttacctagatgacacatttggtctgcaaacgctggacaag
cgaaaggctgttcacatgtacacttttccaggtattgagcacgtcaaatggcatggcagc
gagcaagtattcgacaaagctattaaaccatggctgacttag

DBGET integrated database retrieval system