KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g136833Help
Entry
NEMVE_v1g136833   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NEMVE_v1g136833
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NEMVE_v1g136833
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     NEMVE_v1g136833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 553 aa AA seqDB search
FYKFISKRKEVDLLFRNVSSNGAWVTVDDLEDFMTKDQRFDVTHKTCKELIKKFEVSQRG
KAQLQLGIDGFLSFINSQHASLFNPAHEKIYQDMNQPLSHYFIASSHNTYLLGHQLKGSS
SVQAYRDVLERGCRCVELDCWDGDDEEPIVYHGHTLTSKVLFKDIVQAIKESAFKVSPYP
VIVSLENHCSVQFQIKMAEHLKGILGSLLYTTPVDFTLDALPSPKFFLNKILVRGKTGKS
IVDDKEMDKEIDSFDRKVQIERSVQETDFRGTKEHVADELSQLINYISNEKFKSFIESME
MGHFSQTHSFVESEMLYFLDKSASEFVEFNKHQISRIYPGNLRVDSSNYDPIKPWTVGCQ
IVALNHQTNSEEMQLHYGKFRQNGNTGYVLKPKFLRDPELTFDPDPQDGKFPGIQPKRLQ
LTVISAFQLLEIEESWSLVRDEPDPYVQVEVHGVPADKATFTTHGLTDTTLNPVWNEEFQ
TIVHVPELAMVQFVVYDEDYGFDDFLGQVVIPFESLMEGYRQIQLLDMSGLPLPGTTLFV
HVKISDTDLQAII
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
ttttacaagttcatttcgaaacgaaaggaagtcgatctgttgtttagaaacgtgtcatcg
aatggagcctgggtcacggtcgatgatcttgaggatttcatgacgaaggatcaacgcttt
gacgtcacgcacaagacatgcaaggaattaatcaagaaattcgaggtttctcaacgaggg
aaagcacagttacagctgggaatagatggttttttgtcttttattaactctcaacatgct
agtctttttaaccctgctcatgagaaaatctaccaagacatgaatcaacccctttcgcac
tacttcatagcgtcgtcacacaacacctatttgcttggacatcagttgaaggggagctcc
agcgtgcaggcatatcgagatgtcctggagagggggtgtcggtgtgttgagctggattgc
tgggatggggacgatgaggagcctatagtataccacggccacaccctaacatccaaggtc
ctattcaaggatattgtgcaggcaattaaagagagtgcatttaaggtatcaccttaccct
gtcatagtgtctctggagaatcactgctctgtgcagttccagataaaaatggctgaacat
ttgaaagggatccttggcagtctgctctacaccacccctgttgacttcactttggatgcc
ctaccctccccaaagtttttcctgaacaagattctggtcagaggaaagacgggaaaaagc
atagttgatgataaggaaatggacaaagagattgattcatttgacagaaaagttcaaatc
gaaagatcagtgcaagagacagactttcgagggaccaaggaacatgttgctgatgaatta
tcacagcttatcaactacatctctaatgaaaaattcaagagtttcattgagtctatggaa
atgggtcacttttcacaaacacattcttttgttgagagtgaaatgctgtatttcctggat
aaaagtgcatctgaatttgtagaattcaacaagcatcagataagtagaatttaccctggc
aacctaagggttgattcaagtaactacgacccaattaaaccttggactgttggatgtcag
attgttgcattaaaccatcagacaaattcagaggaaatgcaactacattatggcaagttc
agacagaatgggaacacaggatatgttctcaagccaaaattcctccgtgacccagagttg
acatttgatcctgacccacaggatggaaaattcccaggtattcaacccaaacgcctccag
ctgacagttatcagtgcctttcaactgctggaaatagaagagtcctggtctttggtccga
gatgaacctgacccctacgtccaggtagaagttcatggtgtacctgctgacaaggcaaca
tttaccacacatggccttaccgacaccaccttaaaccctgtctggaatgaagagttccag
acaattgttcatgtcccagagctggcaatggtccaatttgtggtatatgatgaggactat
ggatttgatgattttctggggcaggttgttatcccatttgaatctctgatggagggctat
cggcagatccagttgttggacatgtctggtctgccacttcctggcactactttgtttgtc
cacgtcaaaataagtgacactgacttgcaggctattatctaa

DBGET integrated database retrieval system