KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g136839Help
Entry
NEMVE_v1g136839   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 224 aa AA seqDB search
MEWHSHGINNNDLVTQLRQFDIIKSSRIEEAMRMVDRANYCHHNPYNDSPQFIGYGVTIS
APHMHAHALELLKDNIREGAKVLDVGSGSGYLTAVMAIMVGKTGKVVGIDHIQELVDMSR
KNVLKGNANLLEENRLILVTGDGRKGYSQEGPYDAIHVGAAADPFPEELVKQLKPGGRIL
LPVGPDHGTQWLEQVDKDEEDNVKRKKLMRVRYVPLTNKEEQLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcactctcatggaataaataacaatgatcttgtaacacagctaaggcaattc
gacatcataaagtcaagccgaattgaggaagctatgagaatggttgaccgggcgaattac
tgccatcacaacccctacaatgattctcctcagttcattggatatggagtgacaataagt
gctccccacatgcacgcacacgctttagaattactcaaagacaatataagagaaggagca
aaagtcctggatgtcggatcgggtagtggttatctcactgctgtcatggccattatggtg
gggaagactggtaaagtggttgggattgatcacatccaagagcttgttgatatgtcaaga
aaaaatgtcctgaaggggaatgccaaccttctggaagaaaacagacttattttggtcact
ggtgatggaagaaaaggatattctcaagaaggaccatacgatgccatccatgtgggcgcc
gccgctgatccatttccagaagagttagttaaacagttgaagccaggaggaaggattctt
ctaccagtgggtccagaccatggtacccaatggctagaacaggtagataaggacgaagag
gataatgtcaagagaaagaaactgatgagggtaagatatgtaccattgactaacaaggaa
gagcagttatcttaa

DBGET integrated database retrieval system