KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g137206Help
Entry
NEMVE_v1g137206   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:nve03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1957 aa AA seqDB search
IWKPYKELLAIVERAVTRKSPECHHDLEVALKKFKPDFIALLKNPAKNPNYRQQIKNAHQ
EGIIFSGRQEKQKLPEQFIQEALIISDILDLNELASVELLLAGEQQQPNFPGLTRGLVAV
LLYHDGRRCLVSALKTLIQAREGITWTLGLTDDLCQLITKFTNELREEGLTATILNQLEQ
IDLKVELEKLQKGQAIGDEHHKRQLIDFITDQRQLLAECLYGLACQSPLPRNDCLQLLGY
LKKCQSLEVDGRLDSVTLMVLMAMLYCLNVDPLDDANELQTFINGSLPLLSDPSFIPDLH
RELATSTWLNSGLLATIQFAWSLVLRSCSQWSSLAASAADILEEDEAVLDMAVEGRVFAF
LRSSMVQASIFHHEDYFVRRLHSLITGFIVKMPLKVKELRNHGDEAARILLVHLQEGLEP
PEDLPTHFEDLLLLIGDVYSKDPSGLELATDYWCVPDPVTTPFSPYARAVSPAYRQRLSS
KQVSLNKFVHLAGDLLPLPLFVPYMDMLVGLCTSPQGAHHCFNMLKTTANSTVSWDHFFT
AIKQYYMDLRQNVYHLLPAGGEIHRAHSPNCSVSQTELEGLEAVLRVTERVADQDEVARI
ALCESQVWLPVASLFGLLGCSIPISLKACILNTLAAFAKSPEIAASMWHTLELAQVLQTV
EQPGQPAQGTSGIQAELNELESRSEVYPETRAFLKLMAALTDIPVPTALGIGYRVPGFEP
YLVFLRDQVLLKFSTRAYKDPTEKWQVACGVLEILFKLLDAYSPQPGDFVDQFMEGRGGE
RHLVPKPAGFSIMVHMMNDTQMLQMVLSIIDQASTALDMLTATSEGKDELERATLLCLRV
VEVTLERQETFMDMLRSVVHGSAVMVTPLQHLLMTVNPATQKADYLLKVTKYLTLSHISP
ELSLSAIKILCQVGQSQPVQSHLVGILTADKAMSQKILIGFVDHLDIDEPEEQHTRDMLE
IGEDEKSYGPTQLRNATRQNILQLLLYSLAFPAPNLAHFLLGFELRRPVSKTNIQLPGVL
GAPKTCLHAIVDILNRGVDSHHGPTSIIDAPRFSALAYKLIYCLCANKDTFMPTLRFLRT
SHDFLYQHLQHLPFKQVVAMESSTDLVPPLCIANQQSWLLRIAAIELKVTAQSRQRSHTQ
RLLGLLLNEPSTIGSLNASQMTDIAPRPDDDLSATNISLYQTALYAEPTPNQQPGRRKVL
SILDSVDFSQDFPPQLQLNYFDPGVMERVIASCELKSEETGVQYCNIRELNRLLRNEISN
AQGPNAAGQKNFLFQEVKDILSNVVQRNMVRESLQAKKDAFESWRQVIEVALATCPGDIL
LQDVKQAVILETLQDLLMKIAQEDALQELTSPVSGVIMMLMTHLRHCTNRGNMTTPTSTL
HTSTQDRSFAVSRGNVPSGPLFAVLRGIIEVVLRSGGGLQRVRANLYTALLYFMQIVQKP
DDPKDTGVLEGVLSQPGQSWDLGTLSVLSSYGEPFMEMLCRDACDGHDIGRMLAFSLLNA
IVNVDWQKRWLTYFSMKGFLATIVEGLSQEDEALQTMLYPSPGSLKALYVYESKMSLLTC
IAQSQEGAQALMHAGLLARLAECSFLDQRPEYEFHSSMNGYGDEDSFVPSVMDRYRQLLL
PALQVISTILASLGPQHREASMKVLGVVVSHADVFTSILQDRTPVHTPSSLQELALITGI
ICNAALSETSVLDEDTILEDEIKLRGPLARIQRLMLALLPKYCSSENWDKVSMVPAASPS
SKLSPVAMETAEMLHRICCNVIGYCRTIVSSSGSAKCNIHVVFGPSMADILTRDTHRTRT
DSYRAAAAHTHRPPSLGVLVTVIKGCADQMGRAVDVYKQTSLKQQNMAELTGEELRELSQ
LQATAAPTDKMSTGQRQQLAYKCLTQIVDFKQQEIYTHLYIIESSLFILWRHLDYFYLRC
IPSDEENTLLNQGQASTRMRRLQGKLPLLPTPIWNTP
NT seq 5874 nt NT seq  +upstreamnt  +downstreamnt
atttggaaaccatataaagagttgttagcgattgtggagagagccgtcactcgaaaaagt
ccggaatgccatcacgatttggaagtagcactgaagaaattcaagcctgatttcatcgca
ctgttgaaaaatcctgccaaaaacccaaactacagacaacaaataaagaatgcacatcaa
gaaggcattattttcagtggacgccaagagaagcaaaagcttccggaacaattcatccaa
gaagcactgatcatcagtgacatactagacttgaatgagctagccagtgttgagcttcta
ttggctggtgaacaacagcaaccaaattttccaggcttgacgagaggcctagttgcggtg
ttattgtaccatgatgggaggcgctgcctggtcagtgcattgaaaactttgatccaagcg
agggaaggaataacctggacactaggactcactgatgatctctgtcagttaatcactaaa
ttcacaaacgagctgagagaggaaggtttaacagcaacaattctgaaccagctagagcag
attgacctaaaggttgagcttgagaaacttcaaaaaggccaggctatcggcgatgagcac
cacaagcgacaactgatagacttcatcacagaccagcggcagcttcttgccgaatgtctc
tatgggctggcctgtcaatcacctctgccaaggaacgactgtcttcagttgctgggttac
ctgaagaagtgtcaatcacttgaggttgatggtcggcttgatagtgtgaccctgatggtg
ttgatggcgatgttgtattgtttgaatgttgatccactagatgatgctaatgagttacag
actttcatcaatggttcccttccactgctatctgacccatcattcataccagacctacat
cgtgagcttgcaacatcaacctggttaaacagtggtctcttagcaaccatccagtttgcc
tggtcacttgtcctacgctcatgcagtcagtggtccagcttagccgcgtcagctgcagat
atcttggaggaagacgaggccgtgctggatatggctgtagaggggagagtgtttgctttt
ctcaggtcgtctatggttcaagctagtatttttcaccatgaggattattttgtgagaaga
ctgcattctcttataacgggattcatagtaaagatgccactgaaggtgaaggagttacgt
aaccatggtgacgaggccgcccgtatcctgctggtacacctgcaggagggcctggagcct
cccgaagacctgccaacacattttgaagacctgctacttctgatcggggacgtttacagc
aaagatccaagtggactagaactagccacagactactggtgcgtcccagaccctgtgacc
acacccttctcgccttacgcccgggcagtctcgcctgcctatcgtcagcgcctctcctcc
aagcaagtcagtctgaacaagtttgtccacctggctggggacctgttgcctttgccgttg
tttgtgccatacatggatatgctggttggcctgtgtacaagtccacagggtgcccaccat
tgctttaatatgttaaagacgacggctaatagcacagtgtcgtgggatcacttcttcacg
gcaattaaacaatactatatggacttgcgacaaaacgtctatcacttgttgcccgcagga
ggggaaattcacagggcccattctccaaactgcagtgtgtctcagacggagctggaggga
ctggaggctgtgctgagggtcactgaaagagttgctgatcaggatgaagttgctcgtatc
gccctgtgtgagagtcaagtttggttaccagttgcctctttgtttggtttgcttggatgc
tcaatccctatcagtcttaaggcctgcatactcaacaccctggctgcgtttgccaagtca
ccagagatagcagcctctatgtggcataccttggaattggcacaggttctacagacagtt
gaacaaccagggcagccagcacaaggcactagtggtattcaggccgagttgaatgagttg
gaatcccgtagcgaggtttatcctgagacccgtgcctttctcaagctgatggccgccctg
acagacatccctgtccctaccgcgctgggcatcggctatcgcgtaccagggtttgagccg
tatctagtgttccttagagaccaggtgcttctcaaattcagcacaagagcatataaagac
ccaacagaaaagtggcaagtggcttgtggtgtgctggagatcctgttcaaactcttggat
gcatactcccctcagccaggagactttgtggatcagttcatggaggggaggggtggggag
aggcatcttgtccccaagccagcaggattctcaattatggtacacatgatgaacgacacc
cagatgctacaaatggttctttccattattgaccaagcctcaacagcgttagacatgttg
acagcaacatcagaaggaaaggacgaacttgaaagagccaccttgctttgcttacgggtg
gttgaggtgacacttgagagacaggagaccttcatggacatgctacgaagtgtggttcat
ggctctgccgtaatggtgacaccactgcaacacttattgatgacggtcaaccctgccact
cagaaggcagactacctcctcaaagtaactaaatacctgaccctgtctcacatcagtcca
gagctcagtctctctgccatcaagatcctttgccaggtcggccagtcgcagcctgtgcag
tcacacctggtcgggattctcacagcagacaaggcaatgtctcagaagattctcatagga
tttgttgatcaccttgatatcgacgagccagaggagcagcatacacgagatatgctagag
ataggggaagatgagaagtcctacggtccaactcagttgcgcaatgctacgaggcagaac
attctacagctcctcttatactccctggccttcccggccccaaacctggcgcacttcctt
cttggctttgagctacgcaggccagtgtccaagacaaatatccagttaccaggcgtgctt
ggtgccccgaagacttgccttcatgcaatcgtggacatactaaacaggggtgtcgacagc
catcatggaccaaccagtatcatcgatgcaccccgcttctccgccctagcctacaaactc
atctactgcctatgtgccaacaaagacaccttcatgcccacattgcgcttcttaagaaca
agtcatgacttcctgtaccagcacctacaacacctgccatttaaacaagtggttgccatg
gagtccagcactgacctggtcccgcccctttgtatagccaatcagcagtcatggcttttg
aggattgctgccattgagctgaaagtgacagctcaaagccgtcagcgctctcacacacag
agattgcttggactgctgttgaatgagccctcgacgattggctcactgaatgcctcccag
atgactgacattgccccacgcccagacgatgacctatcggcaacgaacataagtctttat
cagacggcactgtatgctgagccaacaccaaaccagcagccaggccggcgaaaagtcctg
agcatcctagactctgttgatttctctcaagacttccctccacagctacagctgaactat
ttcgaccctggggtgatggagcgagtgattgcatcatgtgagctcaagtcagaagagact
ggggtccagtattgcaacattcgggaactcaacagactcttacgcaacgagattagcaat
gcccagggccccaatgccgccggacagaagaacttcctatttcaggaggttaaggacatc
cttagcaatgttgtacagcgaaacatggtacgcgagagcctgcaggcgaaaaaggatgcc
tttgagtcatggcgccaggtgattgaggtggcattagcgacatgcccaggggatatcctg
ctgcaagatgtcaagcaagctgtgattctagaaactctacaagacttgctaatgaagata
gcacaagaggatgccctacaagaactgacgtcacccgtctctggcgtcatcatgatgctg
atgacacatcttcgacactgcactaaccgcggcaacatgaccacacccacaagcacctta
cacacctctactcaagacaggtcctttgccgtcagccgaggtaatgtcccctcagggccc
ctgttcgctgtcctgaggggcattattgaggtggtgctgaggtctggtgggggtcttcag
cgtgtgagggccaacctttacactgccctgctgtatttcatgcagattgtccaaaaacct
gacgacccaaaggatacaggtgttcttgagggcgtactgtctcagcctggtcaatcatgg
gatctagggacactctctgttctgtcgagttatggggagcccttcatggagatgctttgt
cgggatgcttgcgatggacatgatatcggacggatgctggcattttctcttctcaatgct
atcgtcaacgtcgactggcagaagcgatggctgacatacttctccatgaagggcttcctg
gccacgatagtcgaggggctctcccaagaggatgaggccctgcagaccatgctatacccc
tccccagggtccctcaaggctctgtatgtgtacgagtccaagatgtccctgttgacgtgt
attgctcagtcccaggagggggcccaggccctgatgcatgctggactactagctaggctt
gctgagtgcagctttcttgatcagagacccgagtacgagtttcatagcagcatgaatggc
tatggtgacgaggactcgtttgtgccgtccgtcatggaccggtatcgacagctgctgtta
ccagctcttcaagtcattagcacaatcctggcctcacttgggccacaacacagggaggca
tccatgaaggtgctgggtgtggtggtgtcacacgccgatgtgttcacaagcatcctccag
gaccgcacacccgtacacacgccctcctccctacaggagcttgctctcattacagggatc
atttgtaacgctgctctcagcgagacaagtgttcttgacgaggatacaatcctcgaagat
gagatcaagttgcgtggaccgctggccaggattcagaggctcatgctggcgctacttccc
aaatactgctccagcgagaactgggacaaggtgagcatggtcccagcggcaagcccaagc
agcaaactcagccccgtagccatggaaacagcagagatgctccaccggatctgctgcaat
gtgattggctactgcagaacaatagtcagctcttcaggctcggccaagtgtaatatccac
gtggtgtttggtccaagtatggccgatatcctgaccagggacacacaccggacaaggaca
gacagttaccgtgcagccgctgcgcatacgcaccgccctcccagcctgggtgttctagtg
accgtcatcaaggggtgcgctgaccagatgggccgtgccgtggacgtgtacaaacagaca
agcctcaagcagcagaacatggcagaactcacaggggaagaactgcgagagctgagccag
ctacaggcgactgctgcacccactgacaagatgtccacgggtcaacggcaacagcttgct
tacaaatgcttgacacagatcgtggacttcaaacaacaggaaatctacacccatctttat
atcatcgagagctccctctttattttatggcgacacttggattacttttatcttcggtgc
attccgtcagacgaagaaaacaccctactaaaccaggggcaggcgtcaacccggatgagg
cgactacaaggtaaactacccctcctcccaacccccatatggaacacaccctag

DBGET integrated database retrieval system