KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g137828Help
Entry
NEMVE_v1g137828   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NEMVE_v1g137828
Enzymes [BR:nve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NEMVE_v1g137828
Transcription factors [BR:nve03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    NEMVE_v1g137828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 311 aa AA seqDB search
GANIRFVITNDDGLRIEADSHKVAWRMIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDE
PVTYILEQLADAHLLRNYRFQYNPPFGTNGEDGLTPETYCVNAFCGYRKKMYDMFAFLAS
EYRTPPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRS
GIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDAT
TSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCH
CKSKRCRKYLN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ggtgccaatattcggtttgttattactaacgacgatggactgaggatagaggcggattcc
cataaagttgcttggcggatgatattcgatttggttcgggattcccgctcctcgcactta
ctaaaggatttgccgtttattggtgtgagtgaccgctgcatgattggcgtgacggacgag
cctgttacgtacatcctggagcaattggctgatgcccacctattgagaaactaccgcttc
cagtacaaccctccgttcggcaccaacggcgaggatggacttactcccgagacctattgt
gtaaatgcgttttgcggttataggaaaaagatgtatgacatgtttgcgttcctggcgtcc
gagtaccgaactcccccacagctggacgacaattacgacgagctggaagctgcagagcag
gcgtgggggaacatgacgaccatcaagcgaccgaccactttggacctgcccatggccatg
cgctaccgacatctcaaacagaacaactacaacaagggcaccatcgccgtgttcaggtct
ggtattcacggtcgtggtttgtactgtacgcgacatatcgccgctggtgagatggtgata
gagtactcaggcatgttgataagatccacgctgacggacaagcgagaggcctactacgag
agcaaggggattgggtgttacatgttccgtattgatggaacatatgttgtggacgccaca
acctctgggaatgcagctcgcttcatcaatcactcgtgcgagccaaactgctattcccgg
gttgttaccatcgacggaaacaagaagatccttatctttgcttctaaaagtatctcgcga
ggtgaagagcttacctatgattacaagtttcctctggaggacgagaagctgccttgtcat
tgcaagtccaaacgatgtcggaaatatctgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system