KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g140545Help
Entry
NEMVE_v1g140545   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     NEMVE_v1g140545
Peptidases [BR:nve01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   NEMVE_v1g140545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 247 aa AA seqDB search
GWTRIVGGHDAAPHSWPWQVSLREELGHTCGGTLIAPEWVVTATHCIIMNPSPSSYTVAL
GAHRRLSSNTAEQVIKVKRIFKHSGFSMWRYRDDIALLQLERPAQLNDRVNVACLPSPGD
VPPVGSKCWLTGWGRQVDSSGPLPDILQQARIPIASHEDCKRKYGSGIYSYTHLCAGEAK
PNAAGACQGDSGGPLVCERNGQWTLYGVVSFGAGNCEVTSYTVYTKVSNYLDWITKRAGS
KLLELRH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ggttggacccgaatcgttgggggacatgatgcagcacctcattcatggccctggcaggtg
tcgttacgcgaggagctaggacatacatgtggagggaccttgatcgctcctgagtgggtg
gtgactgctacccattgcataatcatgaatccttcgccaagtagctacaccgtcgcgttg
ggggctcacagaagattgagctccaacactgccgaacaggtcattaaagtcaaacgaata
ttcaagcacagcggtttctccatgtggaggtatcgtgatgacatcgctctgcttcaactt
gagagacccgcgcagctgaacgacagggtcaacgttgcctgtctcccctcccctggggat
gtgccgcctgtagggtccaagtgctggctgacgggatgggggcgacaggtagacagctcg
ggacccctccctgatatcctccagcaagcacgaatacccatcgcctctcatgaggactgc
aagcgaaagtacggctcggggatctacagctatactcacttgtgtgccggggaggcgaaa
cccaacgctgcgggagcctgtcagggggatagtggaggacctttggtctgcgagcgcaat
ggacaatggacgctttatggagtcgtgagcttcggcgcgggaaactgtgaagtgaccagc
tacacggtgtacactaaagtcagcaattatttagactggataacgaaacgggcaggaagt
aagttactggaacttcgacattag

DBGET integrated database retrieval system