KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g142057Help
Entry
NEMVE_v1g142057   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    NEMVE_v1g142057
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    NEMVE_v1g142057
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     NEMVE_v1g142057
Cytochrome P450 [BR:nve00199]
 Cytochrome P450, animal type
  CYP3 family
   NEMVE_v1g142057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 364 aa AA seqDB search
MLTVARGETWHRVRTTVSPIFSTHKMKMMLPLMNSSCDVMMTKLQQAAESGESFNMHRLS
QGLTMDSILKTIFGIESEAQLNFDDPAFVAAREAVDASTFRKILQSIVGILPSPIMKLCS
GVFLSNLNDLVKITEKVIEAKKKQQEPKRKDMLDMMLEAIAEGESKSKHMTEAEVVAQCL
IFMLAGYEGTNSALTFVCYNLATNPDIQEKLQQEIDSVWTDDDQVPSYDMVHQLSYLDMV
VSETLRMYPPAFVQTREVTRDCIIQGRRFRKGTSILMDVYSLHHDPELWPEPERFNPGRF
TAEAKQSRSPYAYLPFGAGPRNCVGMRFSLMEIKLALTRILKKYSFVVTKDTQTPPTLRA
DAVL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgttgcccggggtgagacatggcacagagtgaggacgactgtgtcacccatc
ttcagcactcacaagatgaagatgatgttgccgctgatgaatagctcatgtgacgtcatg
atgaccaagctgcaacaggcggcagagagtggagagtcatttaacatgcacaggttgagt
cagggtctaaccatggactccattcttaagactatcttcggtattgaatcagaagcacag
ctgaactttgatgaccctgcatttgttgcagcacgagaagctgtagatgcaagcactttt
cgcaagattttacaaagcatcgttgggattttacccagccctataatgaagctgtgttct
ggagtgttccttagtaatttgaatgacctggtaaaaatcactgagaaagttattgaagcc
aagaaaaaacagcaagaacccaaaagaaaggacatgctggacatgatgttggaagcaatt
gcagaaggtgaatccaagagtaaacatatgactgaggcagaggttgtagcccagtgtctg
atcttcatgcttgctggatacgaaggaaccaacagtgctctcacctttgtttgttataat
ctggccacaaaccctgatatccaggaaaagttacagcaggagatagacagtgtctggaca
gatgatgaccaggtgccgtcatatgacatggtgcaccagctgtcatacctggacatggtg
gtctcagagacgctcaggatgtaccccccagcatttgtccagacccgtgaggtaactcgg
gactgtatcatacaaggaagaaggtttcgtaaaggcacttcaattctcatggacgtctac
agtctgcaccatgacccagaactgtggcctgaaccagaaaggttcaaccccgggcgattc
acggctgaagctaagcagtcccgcagcccttacgcgtacctcccgttcggcgcgggaccg
cggaactgcgtcgggatgcgtttctctctgatggaaatcaagctagcgctgacgagaatc
ctcaagaagtacagctttgtggtgacgaaagacacccagaccccacccaccctcagggcg
gatgctgtgctt

DBGET integrated database retrieval system