KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g142057Help
Entry
NEMVE_v1g142057   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:nve00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:nve00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 364 aa AA seqDB search
MLTVARGETWHRVRTTVSPIFSTHKMKMMLPLMNSSCDVMMTKLQQAAESGESFNMHRLS
QGLTMDSILKTIFGIESEAQLNFDDPAFVAAREAVDASTFRKILQSIVGILPSPIMKLCS
GVFLSNLNDLVKITEKVIEAKKKQQEPKRKDMLDMMLEAIAEGESKSKHMTEAEVVAQCL
IFMLAGYEGTNSALTFVCYNLATNPDIQEKLQQEIDSVWTDDDQVPSYDMVHQLSYLDMV
VSETLRMYPPAFVQTREVTRDCIIQGRRFRKGTSILMDVYSLHHDPELWPEPERFNPGRF
TAEAKQSRSPYAYLPFGAGPRNCVGMRFSLMEIKLALTRILKKYSFVVTKDTQTPPTLRA
DAVL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgttgcccggggtgagacatggcacagagtgaggacgactgtgtcacccatc
ttcagcactcacaagatgaagatgatgttgccgctgatgaatagctcatgtgacgtcatg
atgaccaagctgcaacaggcggcagagagtggagagtcatttaacatgcacaggttgagt
cagggtctaaccatggactccattcttaagactatcttcggtattgaatcagaagcacag
ctgaactttgatgaccctgcatttgttgcagcacgagaagctgtagatgcaagcactttt
cgcaagattttacaaagcatcgttgggattttacccagccctataatgaagctgtgttct
ggagtgttccttagtaatttgaatgacctggtaaaaatcactgagaaagttattgaagcc
aagaaaaaacagcaagaacccaaaagaaaggacatgctggacatgatgttggaagcaatt
gcagaaggtgaatccaagagtaaacatatgactgaggcagaggttgtagcccagtgtctg
atcttcatgcttgctggatacgaaggaaccaacagtgctctcacctttgtttgttataat
ctggccacaaaccctgatatccaggaaaagttacagcaggagatagacagtgtctggaca
gatgatgaccaggtgccgtcatatgacatggtgcaccagctgtcatacctggacatggtg
gtctcagagacgctcaggatgtaccccccagcatttgtccagacccgtgaggtaactcgg
gactgtatcatacaaggaagaaggtttcgtaaaggcacttcaattctcatggacgtctac
agtctgcaccatgacccagaactgtggcctgaaccagaaaggttcaaccccgggcgattc
acggctgaagctaagcagtcccgcagcccttacgcgtacctcccgttcggcgcgggaccg
cggaactgcgtcgggatgcgtttctctctgatggaaatcaagctagcgctgacgagaatc
ctcaagaagtacagctttgtggtgacgaaagacacccagaccccacccaccctcagggcg
gatgctgtgctt

DBGET integrated database retrieval system