KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g142804Help
Entry
NEMVE_v1g142804   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g142804
Enzymes [BR:nve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     NEMVE_v1g142804
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     NEMVE_v1g142804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 421 aa AA seqDB search
MKIGEKIIEGKTKIVYALPDSPDGNHVLLKSKDKITAFDATRKDEMSGKAAQSTATTCAI
FEMLKACGLKTHFVKRCESDPEAFIGIACEMIPLEVVCRRIATGSFLKRYPGVKEGYRFT
PPKQEFFLKDDAQHDPFWTYEQCVEAAFEIGGKKIGKHELDIMSESAIAIFEIIERAWAT
VDVALVDMKIEFGVNRKTGELMLADVVDNDSWRIWPSGDKRLMRDKQVYRNLPEVTPEAL
EQVKKNYAWVAGESQKLNKHNPGHVVVFMGSASDIDHCKKIEAALKSFNVPCDLRVSSAH
KGSEDTLKVLRVYEGQGVPIVIIAVAGRSNGLGPVLSGNTSFPVINCPPVSSGWGAEDVW
SSLRLPSGLGCTTALNPDGAAAAAAQILGLHDHIIWGSLRAKRLNMAVGLREADDKLVSG
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagattggagagaagatcattgaaggcaagacaaagattgtttatgctctccctgac
tctcccgatggcaaccatgtactccttaaatccaaggataagatcactgcctttgacgcc
acccgcaaggatgaaatgtcaggcaaagcagcccagagtacagccactacctgcgccatc
tttgagatgcttaaagcatgcgggttgaagacccactttgtgaagcggtgtgagtccgac
cctgaggcattcattggaattgcatgcgaaatgatccccctagaggttgtgtgtcgccgt
attgccactggctcattcctgaagcgctacccaggtgtgaaggaggggtacaggttcact
cctccaaagcaagaatttttcttgaaagatgatgcccagcatgatcccttctggacctac
gagcagtgtgttgaggctgcatttgagatcgggggaaaaaagatcggcaagcatgagctg
gacattatgagcgagtctgcaattgcaatctttgaaatcattgagcgtgcttgggcaact
gttgatgtggcccttgttgacatgaaaatagagtttggtgtcaaccgcaagaccggagag
ttgatgctagctgatgtggtagacaacgattcctggcgtatctggccttctggtgacaag
cgtctgatgcgtgacaagcaggtctacaggaatctgccagaggtcactcctgaggctctt
gaacaggtcaagaagaactatgcctgggttgctggtgagagccagaaactcaacaaacat
aaccctggtcatgtcgttgtcttcatgggctctgcaagcgacattgatcattgtaagaaa
attgaagctgctctaaaatctttcaatgtgccatgtgacctcagagttagctctgcccac
aaaggtagcgaagatactcttaaggtgctgagggtctatgaggggcagggagtaccgatt
gttattattgctgtggctggtcgtagtaatggccttggaccagtcctctcaggcaatact
tcctttcctgttataaactgccccccagtatccagtggctggggtgcagaagatgtctgg
tcgtctcttcgtctgccgtctggtcttggctgcactacggctttgaacccagatggcgct
gctgccgctgcagctcaaattctcggcctccatgaccacatcatttggggaagcctgaga
gctaagaggctcaatatggcggtgggcctacgtgaggcagacgacaaacttgtctcagga
aagtga

DBGET integrated database retrieval system