KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g144733Help
Entry
NEMVE_v1g144733   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 161 aa AA seqDB search
DVKPSNILVDESGNFKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDIRS
DIWSLGITMIELATGKFPYTQWKTPFEQLKQVVHEPSPSLPEGPFSLNFRDFVTKSLIKN
YKERPNYNQLLEHPFIKVHMGRNVDVASWLAPFLIELKPPS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gatgttaagccctctaatatccttgttgatgagagtgggaatttcaaactctgcgacttt
ggaatcagtggacaactagtggactctcttgccaagacggtagatgctggatgtaaaccg
tatatggcaccagagagaattaatcctgacagagacatgaagggatacgacatccgctct
gacatctggagccttggaatcacaatgattgaactagctacaggaaaatttccatacact
caatggaaaacaccctttgaacagctgaaacaagttgtccatgaaccatctccttcatta
cctgaagggccattttcattgaacttcagggattttgtcacaaaaagtctcataaagaac
tacaaagaaaggccaaattataatcaactcctggaacatccattcatcaaggtccatatg
ggtagaaatgttgatgttgctagctggctagccccattcctcattgagctcaagcctccc
agttga

DBGET integrated database retrieval system