KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g150703Help
Entry
NEMVE_v1g150703   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g150703
   01230 Biosynthesis of amino acids
    NEMVE_v1g150703
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g150703
   00051 Fructose and mannose metabolism
    NEMVE_v1g150703
   00562 Inositol phosphate metabolism
    NEMVE_v1g150703
Enzymes [BR:nve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NEMVE_v1g150703
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NEMVE_v1g150703
  Exosomal proteins of bladder cancer cells
   NEMVE_v1g150703
  Exosomal proteins of melanoma cells
   NEMVE_v1g150703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 94 aa AA seqDB search
MAWNSIILAYEPVWAIGTGETATPEQAQEMHAFIRGVLATKYNTAIAENTSILYGGSVKP
SNAQEIFSKKDVDGGLIGGASLNIEDFTAIIKAI
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaacagcattattcttgcctacgagcctgtttgggcaataggtactggagag
acagcaacaccagagcaagcgcaagaaatgcacgcgtttataagaggtgtgttggctaca
aaatacaacacagcaattgcagaaaacacttctattctttacggaggtagtgtaaagcca
agtaacgcgcaagaaatattttctaaaaaagatgttgatggcggattgattggcggagct
tcattaaatatagaagattttacagcaattattaaagctatttaa

DBGET integrated database retrieval system