KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g150703Help
Entry
NEMVE_v1g150703   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:nve01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nve01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nve00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nve00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nve00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 94 aa AA seqDB search
MAWNSIILAYEPVWAIGTGETATPEQAQEMHAFIRGVLATKYNTAIAENTSILYGGSVKP
SNAQEIFSKKDVDGGLIGGASLNIEDFTAIIKAI
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaacagcattattcttgcctacgagcctgtttgggcaataggtactggagag
acagcaacaccagagcaagcgcaagaaatgcacgcgtttataagaggtgtgttggctaca
aaatacaacacagcaattgcagaaaacacttctattctttacggaggtagtgtaaagcca
agtaacgcgcaagaaatattttctaaaaaagatgttgatggcggattgattggcggagct
tcattaaatatagaagattttacagcaattattaaagctatttaa

DBGET integrated database retrieval system