KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g152188Help
Entry
NEMVE_v1g152188   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NEMVE_v1g152188
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NEMVE_v1g152188
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NEMVE_v1g152188
Enzymes [BR:nve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NEMVE_v1g152188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 123 aa AA seqDB search
MKRINTKLQEDKKLLSIYFTAGYPKLNDTIPIIHELEKNGVDMIEIGLPFSDPLADGPTI
QESSTIAIENGMTTALLFEQLKGIRETVKIPLIIMGYFNPMMQFGIEKFCQRCAEIGIDG
FII
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattaacactaaacttcaagaagataaaaaattactttccatctattttaca
gcgggataccctaaattaaatgatactataccaattattcatgaattagaaaaaaacggt
gtggatatgattgaaattggattacctttttcagatcctttagcagatggcccaactatt
caggaaagctctaccattgcaatcgaaaatggaatgactacagcacttttatttgaacaa
ttgaaaggaattagagaaactgtaaaaattccactaattattatgggttattttaatccg
atgatgcaatttggaattgaaaaattttgtcagagatgtgctgaaattggtattgatggc
tttattatt

DBGET integrated database retrieval system