KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g153605Help
Entry
NEMVE_v1g153605   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g153605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 83 aa AA seqDB search
QVLKQVHPDTGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL
PGELAKHAVSEGTKAVTKYTSSK
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
caagttctgaagcaagttcatcccgacacaggaatctccagcaaagcaatgggcatcatg
aattcgttcgtgaacgatatattcgaacgcatcgctgcagagtcgtctcggctagcgcac
tacaacaagaagtccacaatcagctcgcgagagattcagactgcaattcgcctactacta
ccaggggagcttgccaaacacgccgtcagcgaggggaccaaagccgttactaagtacacc
agcagcaagtga

DBGET integrated database retrieval system