KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g158158Help
Entry
NEMVE_v1g158158   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    NEMVE_v1g158158
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     NEMVE_v1g158158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 277 aa AA seqDB search
MADSGCLVSESSEKLSNSPSLKRSKQLKAHKSQRIAKDVFDIETTVCRAMCMIDFGFPVC
YIYNPIEYASETHINFLDKYCTSTKKVLFLGMNPGPFGMAQNGVPFGDTSFVKDWLEIDG
EVRKPLKEHPKRPILGLDCKRSEVSGSRLWGLIKQLCKTPEVFFSSCFIHNYCPLVFMNE
SGKNITPPNLPVEQRKQLYNICDQALIEMVELLGTDTVVGIGKFAEGRCRSVLKDSSIRV
YPLMHPSPASPIANAGWSEIAMRQLQEAGLMQVLIVD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcgggttgtcttgtcagcgaaagctccgaaaaactgtcaaattctccctct
ttaaaaagaagcaagcaactaaaagcacacaaatcacaaagaatagccaaagatgtgttt
gacatagaaacaacagtttgtagggctatgtgtatgatcgatttcggattcccagtttgt
tatatttacaacccgattgaatacgcttctgagacgcacataaactttttggacaaatac
tgtactagtactaagaaagttttgttccttggtatgaacccaggcccatttggaatggca
cagaacggggttccttttggagacactagttttgtaaaagactggcttgaaattgatggt
gaagtaagaaaaccgctgaaagagcacccaaagagaccaattctaggtctagactgcaaa
agaagtgaagttagcggctcaagattatggggcctgataaaacaattgtgcaaaacacca
gaagtattttttagcagctgttttattcacaattactgcccactagtatttatgaatgaa
tcaggtaaaaacatcactcctccgaaccttcctgttgaacaaagaaagcagctatacaac
atttgcgaccaggcactaattgaaatggtagagctactagggactgacaccgttgtaggg
attggcaagtttgcagaggggcgttgccgatctgtactgaaggattcaagtataagggtt
tacccattgatgcatcctagcccagcaagccctatagctaatgcagggtggtcagaaatt
gcaatgagacaactacaagaggcagggttaatgcaagttcttattgtggattga

DBGET integrated database retrieval system