KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g158887Help
Entry
NEMVE_v1g158887   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g158887
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NEMVE_v1g158887
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NEMVE_v1g158887
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g158887
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     NEMVE_v1g158887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 384 aa AA seqDB search
MYPLRQLYRQSACLRIATFTRHLIGARMCSSSNHMTEALLETKNNAGIITMNRPKALNAL
NLPMIRKIYPQLKQWDMDPNIGVILIKGTGDKAFCAGGDVRAIAEAGLRGEDLTKDFFRE
EYMLNYAIGTLKTPYVALIHGITMGGGVGLSVHGRYRVATEKTTFAMPETAIGFFPDVGG
AHALPRLSGKLGLFLALTGQRLKGYNVKLAGIATHYVTLEKISALEEALLNLKDPQHQIV
QDVLNDFDKQCSPNQRFVLDEHMDSINRCFSQSSVEEIISALEEEGSPWAAKQIENLNRM
SPTSLKVTLQQLEEGSRLDLGECLKMEYRMSQTFMENKDFYEGIRAVLVDKDNSPKWNPS
SLKEVSKESVESYFKPIGERELVL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatccacttcgacagctgtacaggcaatctgcctgtttacgaatagccacgttcaca
agacatctcataggagctagaatgtgcagctcatccaaccatatgacagaagctctgttg
gagactaagaacaacgctggtattatcacaatgaaccggccaaaggctctcaatgcttta
aaccttccaatgatcagaaagatctacccacagctcaagcaatgggacatggacccaaac
attggagtaatattgataaagggtacaggagataaagcgttctgtgcaggaggtgacgta
cgagccatcgccgaggcaggattgagaggagaggacctaacaaaggatttttttcgagag
gaatacatgttaaattatgcaataggtacactcaagactccttatgtggcacttattcat
ggtattactatgggcgggggagttggtctctctgtccatggccgctaccgtgtagctact
gaaaagacaacttttgctatgcctgaaacagctataggatttttccctgatgtaggtggt
gctcatgctttaccacggctgtctggtaaacttggtctctttctggccttgactgggcag
cgactcaagggatataatgtcaagctggctggcattgcgactcactatgtcactttggaa
aagataagcgccttggaagaggcgctattaaatttaaaggaccctcaacatcaaattgta
caagatgtactaaatgactttgataagcagtgctctccaaatcagcgatttgtattagat
gaacacatggacagcataaatagatgtttttcacaatcaagtgttgaggagatcatttct
gcattagaagaagagggatctccctgggcagccaaacaaatagagaatctcaatcgcatg
tcccctacatcattaaaagtaacattacagcagctggaggagggatctagactggatttg
ggcgagtgcctgaaaatggagtatcggatgtcacagacgttcatggaaaataaagatttt
tatgagggaattcgagctgttctggtcgacaaagataacagccccaaatggaatcccagc
agtttaaaggaagtttccaaggagagtgtagagtcatattttaaaccaattggggaaaga
gagttagtcttgtga

DBGET integrated database retrieval system