KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g159419Help
Entry
NEMVE_v1g159419   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:nve04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNEASLPGDMVTHFDADEIRRLGKRFRKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIT
IFDADGNGEVDFKEFIEGVSQFSVKGDKESKLKFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKETQLQQIVDKTILNADKDGDGKICFSEFCAIVGNMDVHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagcttctttaccaggggatatggtgacacattttgatgctgatgagatt
agaaggcttgggaagcgctttcggaagctagatttggacaattcgggctccttgtctgtt
gaggagtttatgtctttgcccgaactccagcagaaccccctggtacagagagtcataact
atttttgacgcggatggcaatggagaggttgattttaaagaatttattgaaggtgtttca
cagttcagtgtcaagggtgataaggaatctaaactgaagtttgcatttaggatatatgac
atggataacgatggctatatatcaaatggagaactcttccaagtgcttaaaatgatggtt
ggaaataatttgaaggaaacacaactacaacaaattgtagacaaaacgatactcaatgct
gacaaagatggtgatggcaagatatgctttagcgaattttgtgcgattgttggcaacatg
gatgttcataaaaagatggtagttgatgtgtaa

DBGET integrated database retrieval system