KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g160432Help
Entry
NEMVE_v1g160432   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g160432
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NEMVE_v1g160432
   00630 Glyoxylate and dicarboxylate metabolism
    NEMVE_v1g160432
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NEMVE_v1g160432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 530 aa AA seqDB search
MRMNCPKGVEVVSDVHPDHAHILSYQALEFLADLHRRFNYTRKQLLKKRMQIQSEINAGK
KITYPVSNHSKDWKVSAVPHDLQMRHVEITGPTDCKMVINAMNSGADMYMADFEDSLSPT
WKNIVEGQVNLLEANKKTIQFVNPDGSVRELKDKTACLLVRTRGWHLDERHIICDNEPMA
GALVDFGLYFFHNLHVRLAANSAPYFYLPKMETHLETRLWNDVFRAAQDYMGVPQGTIRA
TVMIETLLAAVNMEEMLYEIRDHCCGLNAGRWDYIFSAIKRLQRKQDAIFPDRKQVTMTV
PFMRAYTERLVHVCHQHGAHAMGGMSAFIPSRRNQEVNKVAMEKIRQDKEREVADGFDGT
WVAHPDLVPVAKEIFMKGMNGACNQKHRLREDVNVQVEELVTIQVPGGKITEEGVRVNIS
VALQYLNSWMMGIGAVAINNLMEDAATSEISRAQLWQWRRHGCHLDDGRQFTTELFNTLH
EEELAKLGGPSKGKLGQASHLLKQMVVSDVMEEFLTIPAYEVLCNPSPKL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaactgccccaaaggtgtggaggtggtcagtgatgtccacccggaccatgct
cacatcctatcatatcaagcactggaattcctggctgacctgcataggaggtttaactac
acacgaaaacaacttctgaaaaaacgcatgcaaatccagagtgagatcaatgctgggaag
aagataacctatccagtgagcaaccattccaaagactggaaagtgtcggcagtaccacat
gatcttcagatgcggcatgtggagattactgggcctacagactgtaaaatggtcattaat
gccatgaatagtggcgccgatatgtatatggcagattttgaagattccttatctcccaca
tggaagaatattgtggaaggccaagtgaacctcctggaggccaataagaaaaccattcag
tttgttaacccagatggctcagtgcgcgagctaaaagacaagactgcctgcttgctggtt
cgtactcgtgggtggcacctagatgaacggcacatcatctgcgataatgaaccaatggca
ggggcccttgtggactttggcctttactttttccacaacctgcatgtccgccttgcagca
aactcagctccttacttctacctgccgaaaatggagacccaccttgagacaaggctgtgg
aatgatgtgttcagggctgctcaagactacatgggggtgccacaaggcaccatcagagcc
acagtaatgatcgagacacttctcgctgctgtgaacatggaggagatgctgtatgagata
cgtgaccactgctgcggtctgaacgctggacgatgggactacatattcagtgctataaag
aggcttcagaggaaacaagacgccatcttccctgacaggaagcaggtcaccatgactgtg
ccattcatgagagcctacacagagcgccttgtccatgtttgtcaccagcatggtgcgcat
gcaatgggaggaatgtcagctttcatccccagtaggcgtaaccaagaagtaaacaaggta
gccatggagaagatccgtcaagacaaagagcgtgaggtggccgacggctttgatggaacc
tgggtggcccaccctgacctggttccggttgccaaggagatattcatgaagggcatgaat
ggggcatgtaaccagaaacaccgattgcgtgaagatgtcaatgtccaggttgaagaactg
gtcaccatacaagttcctggtggcaagataacagaggagggagtgcgtgtcaacatatct
gttgctctccaatacctcaacagctggatgatgggtataggtgcagtggcaattaacaac
ttgatggaagatgcggcaacgtcagagatatcccgtgcccagctgtggcagtggcgaagg
catggttgtcaccttgacgatggcaggcagtttactacagagttatttaacacactacat
gaggaagagttagccaagcttggggggccatcaaagggcaaactaggtcaggcatcacat
cttctgaagcagatggtagtgtccgatgtcatggaggagttcttgaccatcccagcatat
gaagtcttatgtaacccatctccaaagctttga

DBGET integrated database retrieval system