KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g161675Help
Entry
NEMVE_v1g161675   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nve00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nve00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:nve00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:nve00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nve00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nve04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 675 aa AA seqDB search
MAKLFQFVLNALLSFILFLQSLEARSFSVDLTNNVFLKDGKPFRYISGSIHYFRVPRIYW
KDRLQKMKFAGLNAVQTYVAWNLHEPEIGTYDFEGENDLEEFIKIAQSVGLLVILRPGPY
ICGEWELGGFPPWLLKNTSIVLRSSKDQVYMDAVDKWMGVLLPKIRPLLYNNGGPVITVQ
VENEYGSYFTCDHDYMSHLENLFRSHLGKDVVLFTTDGFAKSMLDCGTLPSLFTTVDFGA
GVDPKVPFSILRKYQPNGPLVNSEFYPGWLDHWGEKHSTVNPAVMTQYLDMILAMNASVN
LYMFEGGTSFGYMNAKSSQYQPQPTSYDYDAPLSEAGDITLKYRLLLEVIAGYVGPPSGL
PPKNIPKYAYGKVEMKKLGRLLDLVQVLSPNPPVMARLPMTMEQLGQSYGFVLYHTQIPD
KFAHQTVTISIPGIRDRAIIYVGKIRQATVIRVGNKTTASIVIGSFFDLSILVENMGRIN
YGPHLVDPKGILGNVTLGGDVLMDWKMFPLNLKNVLNHYPMLSSVRRDNTSNAPTFFTGE
IPPSVDGVPRDTFLYMDSWTKGQVFINGFNVGRYWPAAGPQISLYVPSSVLYAGQRASKL
FILELDENPCDYPATCYVTFKDTPLLDGPVAPLQRTAGKSYRHLDQQWLSVYTQENVKNP
AIIQHLVHSEHKNIS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctgttccaattcgtgttgaatgccttattatccttcattctattcttacaa
tcactagaagcaaggtccttctctgtggacttaacaaacaatgtgtttttgaaggatggc
aagccttttcgttacatctctggtagcatccactattttcgtgttcctcgaatctattgg
aaagaccgactacagaagatgaagtttgctggattgaatgctgtacaaacatatgttgca
tggaatttacatgagccagagattggaacctatgattttgaaggagagaatgacttagaa
gaatttatcaaaattgcacagtctgttgggcttctagtgatacttagaccaggaccctac
atatgtggtgaatgggaactgggaggttttccaccatggctcctcaagaacacatctatc
gtactgaggtcttccaaggatcaagtgtacatggatgctgttgataaatggatgggtgtc
ttactgccaaagatacggcctctcctgtataacaatggaggccctgttattactgtacag
gtagaaaatgagtatgggagctacttcacatgtgaccacgactacatgtcccatctggag
aacctttttaggagccaccttggaaaagatgtcgtcctcttcaccactgatggttttgct
aagtctatgttggactgtggtaccctgccaagtttattcacaactgttgactttggtgca
ggtgtggatcccaaagtgcctttctccatacttagaaagtaccaaccaaacggacctctt
gtgaactctgagttctacccagggtggctggaccactggggcgagaagcactcaacagtc
aaccctgctgtgatgactcaatacctggacatgatcctcgctatgaatgcttcggttaat
ttgtacatgtttgagggaggaacaagttttggctatatgaatgccaagtcaagtcaatac
cagccacaaccaactagttacgactatgatgcaccactctctgaggctggagatatcacc
ctaaaataccgtctcttgctggaagtgattgcaggatatgttggaccaccatcaggcctg
ccacctaaaaacatacccaaatacgcttatggcaaggtggaaatgaaaaagctagggcgg
cttttagacctagtccaagttctctccccaaatcctccagtcatggcgagactcccgatg
acaatggagcaactcggacagagctacgggtttgttctgtaccacacgcaaattccagac
aaatttgcccaccaaactgtcacgatcagtattccggggattagagaccgtgctatcatc
tatgttggcaagattcgccaagccaccgttatacgagttggcaacaagaccaccgcatcg
attgttatcggaagtttcttcgatcttagcatccttgttgaaaatatggggcgcattaac
tacggtccccaccttgtcgacccgaaaggcattctgggtaatgttaccctcggcggggat
gtactcatggactggaagatgttccccctgaatctcaagaacgtgttaaaccattatccc
atgctttcgagtgttcggcgggataatacttcaaatgcgccgacgttcttcacaggcgag
atacccccatcggtggacggggtgccacgagacacgttcctgtacatggactcctggact
aagggccaggtgtttatcaatggattcaacgtcggtcgttactggccggcagctggtcca
cagatatccctttatgtgccctcgagcgtcctctatgctggtcagcgggctagtaagctg
tttattctggagttggacgaaaacccatgtgattacccggccacgtgctacgtcaccttt
aaagacacgccattactggatggaccggtggcccctcttcaaaggacagcaggcaaaagc
tacagacacttggatcagcagtggctttccgtgtacactcaagaaaatgttaagaatccc
gcaattatacagcatcttgtccacagtgagcataagaatatcagctga

DBGET integrated database retrieval system