KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g161675Help
Entry
NEMVE_v1g161675   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NEMVE_v1g161675
  Lipid metabolism
   00600 Sphingolipid metabolism
    NEMVE_v1g161675
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NEMVE_v1g161675
   00604 Glycosphingolipid biosynthesis - ganglio series
    NEMVE_v1g161675
   00511 Other glycan degradation
    NEMVE_v1g161675
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    NEMVE_v1g161675
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NEMVE_v1g161675
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g161675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 675 aa AA seqDB search
MAKLFQFVLNALLSFILFLQSLEARSFSVDLTNNVFLKDGKPFRYISGSIHYFRVPRIYW
KDRLQKMKFAGLNAVQTYVAWNLHEPEIGTYDFEGENDLEEFIKIAQSVGLLVILRPGPY
ICGEWELGGFPPWLLKNTSIVLRSSKDQVYMDAVDKWMGVLLPKIRPLLYNNGGPVITVQ
VENEYGSYFTCDHDYMSHLENLFRSHLGKDVVLFTTDGFAKSMLDCGTLPSLFTTVDFGA
GVDPKVPFSILRKYQPNGPLVNSEFYPGWLDHWGEKHSTVNPAVMTQYLDMILAMNASVN
LYMFEGGTSFGYMNAKSSQYQPQPTSYDYDAPLSEAGDITLKYRLLLEVIAGYVGPPSGL
PPKNIPKYAYGKVEMKKLGRLLDLVQVLSPNPPVMARLPMTMEQLGQSYGFVLYHTQIPD
KFAHQTVTISIPGIRDRAIIYVGKIRQATVIRVGNKTTASIVIGSFFDLSILVENMGRIN
YGPHLVDPKGILGNVTLGGDVLMDWKMFPLNLKNVLNHYPMLSSVRRDNTSNAPTFFTGE
IPPSVDGVPRDTFLYMDSWTKGQVFINGFNVGRYWPAAGPQISLYVPSSVLYAGQRASKL
FILELDENPCDYPATCYVTFKDTPLLDGPVAPLQRTAGKSYRHLDQQWLSVYTQENVKNP
AIIQHLVHSEHKNIS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctgttccaattcgtgttgaatgccttattatccttcattctattcttacaa
tcactagaagcaaggtccttctctgtggacttaacaaacaatgtgtttttgaaggatggc
aagccttttcgttacatctctggtagcatccactattttcgtgttcctcgaatctattgg
aaagaccgactacagaagatgaagtttgctggattgaatgctgtacaaacatatgttgca
tggaatttacatgagccagagattggaacctatgattttgaaggagagaatgacttagaa
gaatttatcaaaattgcacagtctgttgggcttctagtgatacttagaccaggaccctac
atatgtggtgaatgggaactgggaggttttccaccatggctcctcaagaacacatctatc
gtactgaggtcttccaaggatcaagtgtacatggatgctgttgataaatggatgggtgtc
ttactgccaaagatacggcctctcctgtataacaatggaggccctgttattactgtacag
gtagaaaatgagtatgggagctacttcacatgtgaccacgactacatgtcccatctggag
aacctttttaggagccaccttggaaaagatgtcgtcctcttcaccactgatggttttgct
aagtctatgttggactgtggtaccctgccaagtttattcacaactgttgactttggtgca
ggtgtggatcccaaagtgcctttctccatacttagaaagtaccaaccaaacggacctctt
gtgaactctgagttctacccagggtggctggaccactggggcgagaagcactcaacagtc
aaccctgctgtgatgactcaatacctggacatgatcctcgctatgaatgcttcggttaat
ttgtacatgtttgagggaggaacaagttttggctatatgaatgccaagtcaagtcaatac
cagccacaaccaactagttacgactatgatgcaccactctctgaggctggagatatcacc
ctaaaataccgtctcttgctggaagtgattgcaggatatgttggaccaccatcaggcctg
ccacctaaaaacatacccaaatacgcttatggcaaggtggaaatgaaaaagctagggcgg
cttttagacctagtccaagttctctccccaaatcctccagtcatggcgagactcccgatg
acaatggagcaactcggacagagctacgggtttgttctgtaccacacgcaaattccagac
aaatttgcccaccaaactgtcacgatcagtattccggggattagagaccgtgctatcatc
tatgttggcaagattcgccaagccaccgttatacgagttggcaacaagaccaccgcatcg
attgttatcggaagtttcttcgatcttagcatccttgttgaaaatatggggcgcattaac
tacggtccccaccttgtcgacccgaaaggcattctgggtaatgttaccctcggcggggat
gtactcatggactggaagatgttccccctgaatctcaagaacgtgttaaaccattatccc
atgctttcgagtgttcggcgggataatacttcaaatgcgccgacgttcttcacaggcgag
atacccccatcggtggacggggtgccacgagacacgttcctgtacatggactcctggact
aagggccaggtgtttatcaatggattcaacgtcggtcgttactggccggcagctggtcca
cagatatccctttatgtgccctcgagcgtcctctatgctggtcagcgggctagtaagctg
tttattctggagttggacgaaaacccatgtgattacccggccacgtgctacgtcaccttt
aaagacacgccattactggatggaccggtggcccctcttcaaaggacagcaggcaaaagc
tacagacacttggatcagcagtggctttccgtgtacactcaagaaaatgttaagaatccc
gcaattatacagcatcttgtccacagtgagcataagaatatcagctga

DBGET integrated database retrieval system