KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g162264Help
Entry
NEMVE_v1g162264   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NEMVE_v1g162264
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NEMVE_v1g162264
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g162264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 545 aa AA seqDB search
MIRVDTLLVFAFCLVVLTALCSGDVPASQSNNQWFKDGVSTVKKHLLQRPNTKPAKNLII
FVGDGCDINTNTAGRILKGQLKGQVGEKGWLSYEEFPYTGLSKTYTTNRQGSDSAGTANA
MFTGVKTRSAMIGVNEEVVTNKCETLTEDRKVDSILKLAEEAGMATGFITSMRLTHATPA
NLYAHSASRYWESDKEMVSRGYGNTSCKDMAQQLVDFQGSVGDGIEVVMGGGRRSFLPNT
TRDPEHVNKTGERYDGRNLIQEWLNKREGSVYAWNKTQFDAVDPKTTKHFLGMFESSHMQ
FAIDRDEDVGGEPSIAEMVEKAVSILKNNDNGKGFFLAVEAGLIDIGHHNGIARQALNEV
VNLEEGVAKAVEMTDKEDTLIISTADHGHVFTLTGYPDINSPIFGLMKQDGEVKLALNDN
KPYTILGYMNGPGAVKGVRANLTGVDTGAKDFKQQALYIGYDYDEAHGSQDVGIYSRGPW
AHLLTGVVEQNVIFHVMDHALCLSSSKQGTCSKPEARGGPSASAAMVTALFAPLVAALVT
CLVLY
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgtggatacccttttagtgttcgccttttgtttggtcgttctgacagctctc
tgttcaggtgatgtacctgcttcgcagtccaacaaccaatggttcaaagatggcgtctcg
accgtcaagaagcacctcctccaacgcccaaacaccaagccggctaagaacctaatcatc
tttgtcggagatggatgcgatatcaataccaacactgctggtcggattctgaaaggacag
ctgaaagggcaggtcggtgagaagggttggttaagctacgaggagttcccgtatactgga
ttgtcgaagacttacaccacgaaccgccaggggtcggactcggcaggaactgcgaatgct
atgtttactggtgtcaagacgagatcagcgatgatcggcgtgaatgaagaagtcgtgacc
aataaatgcgagacactcaccgaggaccgtaaggtcgacagtatactgaagctcgcagag
gaagccgggatggcaacaggatttattacctccatgcgtctaacacacgcgacacccgcg
aacttgtacgcgcactccgcaagcaggtactgggaaagcgacaaggaaatggtatctaga
ggatacggcaatacttcatgcaaggatatggctcaacagttagttgacttccaaggctca
gtgggtgatggtatcgaggtcgtgatgggcggtggtcgccgaagctttctcccgaacact
acacgtgatcctgaacacgtgaacaagacaggcgagcggtacgatgggcgtaacctcatc
caggagtggctcaacaagagggaggggtccgtctacgcctggaacaagacccaatttgac
gcagtagatcccaaaactaccaaacattttctaggtatgtttgagagcagccacatgcaa
ttcgcaatcgaccgtgacgaggatgtaggaggagaaccctccatagctgaaatggtggag
aaggctgtctccatccttaagaacaacgacaatggcaagggcttcttcctcgctgttgaa
gctggattgattgacatcggccatcataatggtatcgcccgccaagcccttaatgaggtc
gtgaatttggaagaaggtgttgcaaaggcggtcgaaatgacggacaaagaggacacactg
attatatcaaccgctgaccatggtcacgtgttcaccttgactgggtacccggatataaat
agccccatatttggactaatgaagcaggacggtgaagtgaagcttgcattgaatgacaac
aagccttataccatcctgggctacatgaacggaccgggggcagtcaagggggtaagggcg
aacctcacaggggtggacacgggagctaaggacttcaagcagcaagcgctgtacattggt
tatgattatgacgaggctcatggaagtcaggatgttggcatatactcacgcggaccgtgg
gctcatctattgacgggcgtggtcgagcagaatgtcattttccacgtgatggaccacgcc
ctgtgtctgtcaagcagtaaacagggcacgtgctccaagcccgaggcacgtggggggcct
tcagcatctgctgccatggtaaccgcactattcgcccctcttgttgccgcacttgtcacg
tgcttagtgctttactaa

DBGET integrated database retrieval system