KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g162805Help
Entry
NEMVE_v1g162805   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    NEMVE_v1g162805
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   NEMVE_v1g162805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2475 aa AA seqDB search
MQQLRPQLLSGLKSRSDESRLQAAKDLQHYVSTELREASPEQYGSFMDEFNHHIFEMVSS
SDANEKKGGIMAIVGLIGISGGSATKVSRFANYLRNLLPSNDTAVMEMASKAMGRLALTG
GTFTADYVEFEVKRALEWLGGDRNEGRRHAAVLVLRELAVNAPTFFFQQVQPFFDNIFNA
VRDPKQAIREGAMEALRACLVILAQRETKEIRKPPIWYSQTYEEAKKGFEGSTNTKEKGV
VLTKEDKAHGSLLIINELIRSASLEGEQYKKDLEDIYCDQVQSNVMSLNDLGITSPKSKF
SYQTGSHTHPTLSSLASGTQLGEINPLCHSKVCKEFMEDKFDEVCILVLYYSGTRNSTIQ
QTLLTLLPRLAAFQPQKFVKKYLKESMQYLVGALKRDRERSSAFKAIGLLAIAVRHNIEP
FSKPVVEQVKQSLPMRDLGHKRQKAVTVDPMVFACVAMLSRAIGPKISKDVKELLEPMLS
VGLSPALTACLHDLAHQVPQLKKSIQDGLLKMLSLILMQKPLRHPGAPKSTPALTPSTSS
HSLFDSSDVTSTVLALRTLGSFDFEGHLLTHVNLVRNCAETFLASEFKDIRMEAVRTCSR
LLSPSLHPMVVTNAPQHGPISATSTQVVSEVLSKMLMVGITDPDPDIRHCVLSSLDERFD
AHLAQAENLAALFVALNDEEFEIREVAISIISRLSNLNPAYIMPSLRKALIQILTELEYS
GVGRSKEQSARMLGHLVSNAPMLIRPYMEPILKALIPKLRDPDPEVVISVLAAIGEHAQV
SGTKMCKWMNELFPIIIDMLQDASSMAKRKIALWTLGQLVESTGYVVEPYRKYPNLLEVL
LNFLKTEQAPGIRREAIRVLGLLGALDPYKHKLNQIEGVLDDGGISTGSKESETAVCDDR
VDTSTSEMLVTMGSVVLEEFYPAVVISALMRIVRDPSLSSHHTMVIQAVTFIFKSLGMKC
VTYLSQIMPSFLNVIRTCDSGFREFVFQQLGVLISIVKQHIRNYLDDIFTLIKEYWTINS
PMQTTIVLLVEQIAVALGGEFKNYLPQIIPHILKVFMHDNSPQRSVTTKLLNALQMFGSS
LDDYLHLLVPPVVKLFDSNEIPLSVRKCALETLDRLSESLDLTDFASRIIHPIVRTLDSC
SELRGTAMDTLSSLVFQLGKRYSTFIPTVNKVLIKHKIQHQRYDVLICKIVKSNFVLDWE
NDLLLRRQKLVRGNFADDSATTAAIEAASIKKLAFKPDSLQKAWGASRCVSKDDWMEWLR
RLSVELLKESPSPALRSSWATAQTYPPLARDLFNAAFVSCWSELHEELQNELVKNLELAL
KSQIPEITQTLLNLAEFLEHTEKGALPLSSDLLGEQASKCRAYAKALHYKEEEFHRVPNT
ETLEALISINNKLQQPEAAHGVLVYAQRMHGADEIRERWYEKLHDWENALNAYKKKLDQD
PEDIHLTLGRMRCMEALGEWGELHTVACDKWPDVSDDIRKQMARMAAAAAWGLGNWESME
EYTCLIPRDTQEGAFYRAALALHHDNFQQAQACIDAARDLLDTELTARAGESYNRAYGAM
VSVQMLSELEEIIQYKLVHERREDIKRTWWNRLQGCQRVVEDWQKILQVRSLVLTPQEDM
QSWLKYSSLCRKSGRLALSHKTLVMLLGSDPSKHPDLPLPTTYPQVTFAYMKHLWREGQK
EEAFQHLHFFVHTTLHQQALQSLSPNDDDNKREELLKLVARCYLKLGDWQSSLQGFNENT
IPQILLYYSAATENDKSCYKAWHSWAFMNFEAVLYYKNQQEKEKSEGLSPGHPSSPSASP
KTVNPVITYAKPAVHGFFKSIALSSGNSLQDTLRLLTLWFDYGHLPEVYEALVEGIKTIQ
IDTWLQVIPQLIARIDTPRQLVGRLIHQLLTDIGKHHPQALIYPLTVASKSASSARHNAA
NQILKNMCEHSQQLVQQAVMVSEELIRVAILWHELWHEGLEEASRMYFGEGNVKGMFAVL
DPLHQMMERGPQTLKETSFNQAYGRDLMEAQEWCRRYQKSGNVKDLTQAWDLYYTVFRRI
SKQLPQLTSLELQYVSPKLLMSRDLELAVPGTYEPHKPVIHIRNVHSSLNVITSKQRPRK
LCLAGSNGSDFMFLLKGHEDLRQDERVMQLFGLVNTLLASDPETSKRHLSIQRYAVIPLS
TNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLTMAPDYDHLTLMQKVEVFEHAL
ANTNGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYVLGLGDRHPSNLMLDRLTG
RILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGIDGNYRLTCESVMRTMREHK
DSVMAVLEAFVYDPLLNWRLMDNAAPKIKRSKGRSDTMTEAAEEMLEGVDVNRDKPSAKK
PAEPLHSIEEETGHKPEFLNKKALDIITRVRDKLTGRDFANRNTLDVPTQVDLLIKQATA
HENLCQCYIGWCPFW
NT seq 7428 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaactacgaccacaattgctttccggactcaagagccgctcggacgagtcacgg
ctacaggcagcgaaagatctccaacattacgtgtcgaccgagctgcgggaagcatctccc
gagcagtatggctcgttcatggatgagttcaaccaccatatatttgagatggtttctagt
tcggatgccaatgagaagaaaggtggtataatggctatagttgggttgatcggtatctct
gggggaagtgcaaccaaggtgagccggtttgcaaactatttgcgaaacctgttgccgtct
aatgacactgcagtgatggaaatggcgtccaaggcaatgggtcgtctagccctaacaggg
ggaacattcactgctgattatgtagagtttgaagtcaaaagggcattggaatggcttgga
ggtgacagaaatgaagggagacgtcatgcagctgttcttgtattacgagagctagcagta
aatgcaccaacattctttttccaacaagtgcaaccattttttgacaacattttcaatgca
gttcgtgaccccaagcaagccattagagagggtgctatggaggctcttcgggcctgtctg
gtcattctggctcaaagagagacaaaggagataagaaagccccctatttggtatagtcaa
acctacgaagaagccaagaaaggttttgagggctcaacaaacaccaaagagaagggtgtg
gtcttgacaaaggaggacaaagcacatggctccttgctaataatcaatgagctgatcaga
agtgctagtcttgagggagagcaatataaaaaagatctggaagacatttactgtgatcaa
gtccagagtaatgtgatgagcctgaatgatcttggaataacttcaccgaaaagcaagttc
tcgtaccagacagggtcccacacccaccccacgctctcttcactggccagcggaactcaa
ctaggggagatcaaccccttgtgccatagcaaagtttgtaaggaattcatggaagataag
tttgatgaggtgtgcattcttgtgctctactatagtgggacaagaaatagcaccattcaa
cagactcttctaactctcctgccaagactggctgcattccagccacagaaatttgttaaa
aagtatctgaaagaatctatgcagtatcttgtcggggcattgaaaagagaccgtgagaga
tcttctgctttcaaagccataggcttgcttgctattgctgttcgccacaacattgaaccc
ttcagcaaacctgttgttgagcaggttaaacagtctctacccatgagggatttgggccac
aaacggcagaaggcagtgacagtggacccgatggtgttcgcatgcgttgctatgctgtct
cgagcaatcggccctaagatatcaaaagatgtgaaagagctgttagaacccatgctttct
gtagggttaagtcctgcgctaactgcctgtttgcatgacctcgcccaccaagttccacag
ttgaagaagagcatacaagatggcctccttaagatgttgtcattgatcttgatgcagaag
cctcttcggcatcctggagctcccaaaagcactccagcactaaccccatccacctcctct
cactccttattcgactcgtcagacgtcacaagcacagttcttgcacttagaactctaggg
tcgtttgactttgagggtcatctcctgacccatgtgaatctagtgcgcaactgcgccgag
acgtttctggccagcgagttcaaggacattcggatggaagccgtcaggacttgttcaagg
cttctctcaccttccctacatccgatggtggtgaccaatgcccctcagcatggtccgatt
agcgccacgtccacacaggtcgtgtctgaagttctcagtaagatgcttatggttggcata
acagatccagacccagacatccgccattgtgtcctgtcatccctggacgagcggtttgac
gcccatctcgcccaagccgagaaccttgctgctctttttgtagctttgaatgacgaggag
tttgagatccgagaggtggccatcagtattatcagcaggcttagcaaccttaacccagcg
tacattatgccttctctcagaaaggctctcatacagattctcacagagctagagtatagc
ggtgtcgggcgaagtaaggagcagagtgcccgtatgttgggccatcttgtgtctaacgca
cccatgctcatcagaccgtacatggagcccatactaaaggccttgatcccgaagctgcgt
gacccggacccagaggttgtcatcagtgtacttgcggcgattggagaacacgcgcaggta
agcggtacgaagatgtgcaagtggatgaacgagctcttcccaattatcatcgatatgctt
caagatgcttcttccatggctaagcgcaagattgctctatggactctcgggcaactggtg
gagagcacgggctatgtggtcgaaccgtatcgaaagtatccaaaccttttggaggtgctc
ctcaactttttaaagacggaacaagcaccaggcataagacgcgaggctatccgcgtactg
ggtctgctaggggcactagatccatacaaacacaagctgaaccagattgagggagtgttg
gatgatggcggcatctctacaggcagtaaagagagtgaaacagctgtttgtgatgatcgc
gtagatacgagcactagcgagatgctggtgacgatggggagtgtggtgctggaggagttc
tacccggctgtcgttatatcagcactgatgagaatcgtccgggatccaagtctgtctagc
caccacactatggtcatacaggctgtcacatttatcttcaaaagtttgggtatgaaatgt
gtgacctatttatcccagattatgccttccttcctgaatgttatacggacatgcgactcg
ggattccgcgagtttgtgttccaacagctcggggtccttatctctatcgtcaagcagcat
atcagaaattacctagacgatatcttcaccttgatcaaggaatactggaccatcaacagt
ccaatgcaaactactatcgtcctgctcgttgagcaaatcgcagtggcactcggaggggag
ttcaagaattacttgccgcaaatcattcctcacatcctgaaggtgtttatgcatgataac
agcccgcagagaagtgtcactacaaagcttctgaacgctctgcagatgttcggttcaagt
ttggatgactaccttcaccttcttgtgccaccagtcgtcaagctctttgactccaacgag
atccctcttagcgtcaggaaatgcgcgctggaaacactggaccggttgagcgagtccctg
gatttgacggactttgcatcacggatcatccaccctatagtgcgaaccctggactcgtgt
tcagagctccgaggtactgccatggataccttgtcatctcttgtgttccagcttggcaag
cgttactcaacgttcatccctaccgttaacaaggttctcatcaaacacaaaattcaacat
cagcgatatgacgtcctgatctgtaagattgtcaagagtaattttgtgctggattgggaa
aatgatctgttgttacggcgtcagaagttggtgcgcggcaactttgctgatgactcggca
actaccgccgcaatagaggctgcaagtatcaagaaactcgcctttaagccagatagcctg
caaaaggcgtggggagcctcgcgctgtgtgtccaaagatgactggatggagtggctgagg
cgacttagtgttgaattgctcaaggagtcgccctcgcctgcgctaagatcaagctgggct
actgctcagacctacccccctctagcaagagatctcttcaacgctgcgtttgtgtcgtgt
tggtccgagcttcacgaagagcttcagaatgagctcgtgaagaacctggaacttgcgctc
aagtcacagatacccgagatcacccagacgctactgaacctcgctgaattcttggaacac
accgagaagggtgcattaccgctgagcagtgatctgctgggtgagcaggcgtctaagtgc
cgtgcctacgccaaggcgttacactacaaagaagaggaattccacagggtgcccaacacg
gagacactcgaggcgctcatcagtattaacaacaagttacagcagcctgaagcagcacac
ggagtattggtgtacgcacagcgtatgcacggagcagatgaaatccgagaacgctggtac
gagaagctgcacgattgggaaaatgccttaaatgcgtacaagaaaaagctggatcaggac
ccagaggacattcacctcaccttgggccggatgagatgtatggaggccctaggagaatgg
ggagagctgcacacggtggcgtgtgacaagtggccggacgtgagtgatgacatcagaaag
cagatggcgcgtatggctgctgcggctgcgtggggactaggcaactgggagagcatggag
gagtacacgtgtcttattcctcgcgacacgcaagaaggcgctttctaccgcgcggccctt
gcccttcaccacgacaacttccagcaagcgcaagcatgtatcgatgcagcgcgtgattta
ctagacacagaactgacggctcgcgccggggagagctacaacagggcgtatggggcgatg
gtgtccgtgcagatgttgtctgagctggaggagatcattcagtacaagcttgtgcatgaa
cgacgtgaagatatcaagaggacttggtggaaccgtctgcagggttgtcagcgcgtggtt
gaggactggcagaagattctccaagttcgctcactagtcctgacgcctcaagaagacatg
caatcatggctcaagtattctagcttgtgcaggaagagcggccgccttgcacttagccac
aaaaccctggtgatgctactgggaagtgacccatccaagcaccccgacttgcccctccct
acgacgtacccccaggtcaccttcgcttacatgaagcacttgtggagagaggggcagaag
gaagaggcttttcagcacttgcatttctttgtgcacacaaccctgcatcagcaagccctg
cagtcgctctccccgaacgacgatgacaataaacgagaggaactgctcaaactggtggca
aggtgttacctgaaactgggagattggcaatcctcgctccagggcttcaatgaaaacacc
attcctcaaattctactctactattctgcagccacagagaacgacaaaagctgctataag
gcgtggcactcgtgggcatttatgaattttgaggcggtgctgtactacaagaaccaacag
gagaaagaaaagagcgaaggcctgtcacctggccacccgtcttccccctcagcctcacct
aagacggtcaacccagtcataacgtatgctaagcccgcggtgcatggctttttcaagtca
attgccctgtccagtggtaattcgttacaagacacgctcaggttgcttaccctgtggttc
gactatggccatctgcctgaggtgtacgaagctttagtggaaggaataaagaccatccag
atagacacatggctacaagtcatccctcaattgatagcaaggatcgacaccccgcggcaa
cttgtcggtcgtcttattcaccagctgctgactgacattggcaagcatcaccctcaggct
ttgatttatcctctgacggtggcgtctaagtcagcaagcagtgcccgtcataatgcagca
aatcagatcttgaagaacatgtgtgagcacagccaacaacttgtacagcaggctgtgatg
gtgagcgaggagctgatccgagtagccatactatggcacgagctgtggcacgaggggctg
gaggaggcgtcacgcatgtacttcggtgaaggtaacgtcaaaggcatgttcgctgtactc
gaccctctgcatcagatgatggaacgaggccctcagactctcaaggagacctccttcaac
caggcgtacgggcgcgatcttatggaggcgcaggaatggtgccggagatatcagaagtct
ggtaatgtaaaggacctgacgcaggcgtgggatctgtactacaccgtgttcaggcgcatc
tccaagcagctgccacagttgacgtcgttagagctccagtacgtctcccctaagcttctg
atgtcacgtgacctggagctggctgttcccggtacttacgagcctcataagcctgttatt
cacatccgaaacgtgcactcgtccctcaacgtgatcacctccaagcaaagaccccggaag
ctgtgtcttgcaggcagcaatggctcggacttcatgttcttgttgaagggtcacgaggac
ctgcggcaagatgaacgcgtcatgcagctgttcggacttgtcaacacattgctagcaagc
gaccccgagacgtccaagagacatcttagcatccagcgttacgctgttatcccactttcc
accaactccggattgatcggctgggtaccgcactgcgacacgctgcacgcccttatccgg
gactacagagagaagaagaagatactgctaaatatcgagcatcgcatcatgcttacgatg
gcgcctgactatgatcacttgacgctgatgcaaaaggtcgaggtgtttgagcatgcgctg
gccaacaccaatggcgacgacttggctaaacttctctggctgaagagtcccagctctgag
gtgtggttcgaccgtcgcactaactacacgcgctccctcgctgtcatgtcaatggtcgga
tatgtgcttggtctaggagacaggcacccgtctaatctgatgctggatcgtctgactggg
cgaattttacacatcgatttcggtgattgcttcgaggtggccatgacgagagagaaattc
ccggagaaaataccgttcagattgacgcggatgttgacaaatgctatggaggtgactggt
atcgatggtaactaccgtctgacctgcgagagcgtgatgcgcaccatgcgtgaacacaag
gatagcgtgatggccgtactggaggccttcgtctacgatccgctgctgaactggcgcctt
atggataatgctgctccgaagatcaagagatcaaaaggtcgttcagacactatgaccgag
gccgcagaagaaatgttggaaggtgtagacgttaatcgagacaagccaagtgccaaaaag
cctgccgagcctcttcattctatcgaggaggaaactggccacaagccagagtttttaaac
aagaaagcgctagacatcatcacccgcgtccgtgacaaactcaccgggcgggactttgcg
aatcgtaacacactggacgtcccaacgcaagtagatctcctaataaaacaagcaactgcg
catgagaatttatgccagtgctacatcggctggtgtccgttctggtag

DBGET integrated database retrieval system