KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g163153Help
Entry
NEMVE_v1g163153   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:nve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NEMVE_v1g163153
   04142 Lysosome
    NEMVE_v1g163153
Exosome [BR:nve04147]
 Exosomal proteins
  Proteins found in most exosomes
   NEMVE_v1g163153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1677 aa AA seqDB search
MAQILPIRFQEHLQLQNVGINAANIGFSTLTMESDKFICVREKVGETAQVVIIDLADANN
PTRRPISADSAIMNPKSKVIALKAGRTLQIFNIEMKSKMKAHTMVEDVTFWKWISVNTIA
MVTDTAVFHWTMEGDSQPTKVFDRHSSLAGCQIINYRTDKTQQWLLLIGISAQQNRVVGA
MQLYSVERKVSQPIEGHAAAFCPFKAEGNQSESNLFCFAVRGPQGGKLHVIEVGTPPAGN
SPFAKKAVEVFFPPEAQNDFPVAMQVSEKHGIVFLITKYGYIHLYDLESCTCIYMNRISG
DTIFVTAPHDPTGGIIGVNRKGQVLSVSVEEENIIPYITNVLQKPDLALRLAVRNNLAGA
EELFVRKFNTLFNNMQYSEAAKVAANAPKGVLRTPQTIQRFQQVPAQPGQTSPLLQYFGI
LLDQGKLNKFESLELCKPVLQQGKKQLLEKWLKEEKLECSEELGDLVKQVDPTLALSVYL
RANVPAKVIQCFAETGQFQKIVLYAKKVNYNADYIFLLRNVMRVNPEAGSSFASMMVQED
GEPLADLNMIVDVFMETNQVQACTSFLLDALKNNRPTEAALQTRLLEMNLLTAPQVADAI
LGNQMFTHYDRAHVAQLCENAGLLQRALEHYTDIFDIKRAIVHTHLLNPEWLVNYFGSLS
VEDSLECLRAMLSHNIRQNLQICVQVATKYHDQLSTNALIELFESFKSFEGLFYFLGSIV
NFSQESDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKSLIMAVRGQ
FSTDELVAQVEKRNRLKLLLSWLEARIHDGSEEPATHNAMAKIYIDSNNNPERFLRENTF
YDSRVVGKYCEKRDPHLACMAYERGQCDQELIKVCNENSLFKSLSRYLVRRRDPELWASV
LLETNQYRRQLIDQVVQTALSETQDPEDVSCTVKAFMTADLPNELIELLEKIVLENSVFS
DHRNLQNLLILTAIKADRIRVMEYITRLDNYDAPDIASIAIGSELYEEAFAIFKKFDVNT
SAIQVLIENIQNLDRAYEFAERCNEPSVWSQLAKAQLQEGMIKEAIDSYIKADDPSTYME
VVEAANSAGNFEDLVRYLQMARKKARDTFVETELIFAYARTNRLAELEEFISGPNHAQIG
QVGDRCYDAGMYDAAKLLYNNISNFAKLASTLVHLGEYQAAVDGARKANSTKTWKEVCFA
CVDGGEFRMAQMCGLHIVVHADELEELINYYQNRGFFEELIGLMEAALGLERAHMGMFTE
LAILYSKYKPSKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYEKYEEYDNAVQTMM
QHPTVAWKEGLFKDVICKVANIELYYRSLQFYLDFKPMLLNDLLLVLTPRMDHTRAVAFF
AKVKHLPLVKPYLRSVQSHNNKSINEALNDLLIEEEDYNGLRASIDAFDNFDNINLAQRL
EKHELIEFRRIAAYLYKGNNRWQQSVELCKRDKLFKDAMMYAAESRKKQTAEDLIHWFLE
IGHNECFAACLFMCYDLLSPDYVLELAWRHKLIDFAMPYIIQVLKEYIDKVDKLRAQEAE
RKDQEETKQDAPIVFDNPQLMITAGPAFAPPGFAGPQGMPAMPPQQQPYGFQPGYGM
NT seq 5034 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaattttacccattcgtttccaggaacatttacagctccagaatgttggaatc
aatgccgcaaacattggtttctccactctcacgatggagtctgataagttcatctgtgtg
cgagagaaagttggagagactgcgcaagtggttattattgacctagcggatgccaacaac
cctacacgcaggccaatctctgctgactctgctatcatgaatcccaagtcaaaagtgatt
gcactgaaagctggccgcactcttcagatcttcaacatcgagatgaagagcaagatgaag
gctcacaccatggtagaagatgtcaccttttggaagtggattagtgtcaatactattgct
atggtaactgatactgctgtattccactggaccatggaaggtgactcccagccgacaaaa
gtatttgaccgtcactccagcctggctggctgtcagatcatcaactaccgaactgacaag
acccagcaatggcttctactgattggtatctcagcccagcaaaaccgtgtggttggagca
atgcaattgtactcagtagaacgtaaagtgagtcaacctattgagggtcatgctgcagca
ttttgtcccttcaaggccgagggcaaccagagtgaatccaacctcttttgctttgccgtc
cgtgggcctcagggtggaaagcttcatgtgattgaagtagggactcctcctgctggaaac
agcccttttgccaagaaggctgtagaagtattcttccctccagaagcacagaacgacttc
ccagttgctatgcaggttagcgagaagcatgggatagttttcctgattaccaagtacggc
tacatccacctgtatgacctggagagctgtacatgcatctacatgaaccgcatcagcggt
gataccatctttgtcacggcaccacatgaccctactggtggaatcattggggttaaccgc
aaaggccaggttctttctgtgagtgtggaagaggagaacattatcccgtacatcaccaac
gtgctgcagaagccagacctcgccctgagacttgcagtcaggaacaatcttgctggcgca
gaggagctatttgtgcgcaaattcaacaccttgtttaacaacatgcagtactcagaggca
gccaaagttgcagctaatgcacccaagggtgtcctgcgtacacctcaaaccatccagaga
ttccagcaagttccagcccagcctggacagacctcgccactgcttcagtattttggtata
ctgctggaccagggcaagctgaacaagtttgagtccctggagttatgcaaacctgtgctg
cagcagggcaagaagcagttgctggagaaatggcttaaggaggagaagcttgagtgcagt
gaggaattaggagacttggtgaagcaggtcgaccccacccttgccctgtccgtctacctt
agggccaacgtccctgccaaggttatccaatgctttgccgagactggacagttccagaag
attgtcctctatgccaagaaagtgaactacaacgcagactacatcttcctgctgcgtaat
gtgatgcgggtaaacccagaagctggatcctcctttgcctcaatgatggtccaagaggat
ggtgaacccctagccgacctgaacatgattgtggatgtgttcatggagacaaaccaagta
caagcgtgtacttcttttcttctggatgctctgaaaaacaacaggcctactgaggctgcc
cttcagactcgtttgctggaaatgaacctgctaaccgcaccccaggttgctgatgctatc
ctcggcaaccagatgttcactcactatgacagggcgcatgttgctcagctctgcgagaat
gctggacttcttcagcgggctttggagcactacacagatatctttgacatcaagagagcc
attgtccacactcatcttctcaatcctgagtggcttgtgaattattttggttccctgtcg
gtggaggactctctggaatgcctgcgtgcaatgctcagccataacataaggcagaacctg
cagatctgtgtccaggtagccaccaagtaccacgaccagctgtccaccaatgccctcata
gagctctttgagtcattcaagagctttgaaggtctcttctatttccttggttccatcgtc
aactttagccaggagtcagatgtacatttcaagtatatccaggctgcttgcaaaactggc
cagattaaggaagttgagcgcatctgccgtgaaagcaactgctatgaccctgagcgtgtg
aagaatttcctgaaagaggccaaactgacagatcagcttccactcatcattgtgtgcgac
aggttcgactttgtgcatgacctggtgctctacctttaccgcaacaacttgcagaagtac
attgagatctatgtgcaaaaggtgaacccatcccgtcttcccgtggtggttggtggcctg
ttggatgttgactgctctgaggacatcatcaagagtctcattatggctgtgcgtggccag
ttctccacagatgagctggtagcacaggtagagaaaagaaacagactcaagttgctgctc
tcttggcttgaggcaaggattcacgatggctcagaagagccggccactcataatgccatg
gcgaagatctacatagactcgaacaacaaccctgagagattcctcagggaaaacacgttc
tatgacagccgcgtggtaggtaagtactgcgagaagcgtgacccccatcttgcctgcatg
gcgtatgagcgaggccagtgcgaccaggagctcatcaaggtctgcaatgagaactcgctc
ttcaagagcttgtcacgatacctggtgcgaaggcgcgatcctgagctgtgggcaagcgtg
ctcctggagaccaaccagtacagaaggcaactaatagaccaggttgtccaaacagccctg
tctgagacccaggacccggaggatgtctcgtgcacagtgaaggcgttcatgaccgctgat
ctccccaacgagctgatcgaactcctggagaagattgtgcttgaaaactcagtgtttagc
gatcacagaaacctgcagaacctgttgatcctgacggccatcaaggctgatcgaatacgc
gtcatggagtatattacccgactggacaactacgatgcgcctgacatcgctagtattgcc
atcggcagtgagctgtacgaagaggcattcgctatcttcaagaagttcgatgttaacact
tctgctatccaggtacttattgagaacatccagaatctggaccgtgcatacgagttcgcc
gagcgctgtaacgagccgtcagtatggagccagcttgctaaggcccagctacaggagggg
atgattaaggaggcgattgactcgtacattaaggcagatgatccttcaacctacatggaa
gttgtggaggccgctaactcggcaggcaatttcgaggacttggtgcgttacctgcagatg
gcccgcaagaaggctcgtgacacattcgtggagactgagctgatttttgcgtatgcgcgc
accaacagacttgcagagctggaggagtttatctctgggcccaaccacgcccagattgga
caggtcggtgaccgttgctatgacgcggggatgtatgatgccgctaagctactgtacaac
aacatctctaacttcgccaagctcgcgtccacacttgtgcacctgggcgagtaccaagct
gccgtggatggggcacgcaaagcgaacagcaccaagacttggaaggaggtgtgctttgct
tgcgttgatggcggcgagttccgcatggcccagatgtgcggtctccacattgtggtccat
gctgatgagctggaggagcttatcaactactaccagaaccgcggcttcttcgaagagttg
attgggctgatggaggcggctctgggactggagagagcccacatgggcatgttcaccgag
ctggccatcctctactccaaatacaagccttcaaagatgagggagcacctggagctcttc
tggtcacgtgtcaacatccccaaggttctgcgggctgccgagcaagctcatttgtggtcc
gaacttgtgttcctgtacgagaaatatgaggagtacgataatgcggtgcagacgatgatg
cagcacccaaccgtcgcatggaaagaggggcttttcaaggatgtcatttgcaaggtcgcc
aacattgaactttattacagatctcttcagttctaccttgacttcaagccaatgctgttg
aatgaccttctcctggtgcttactcctcgtatggaccacacacgtgccgtggccttcttc
gctaaagtcaagcacttgcctctggtcaagccatatctgcgctcagtacagagccacaat
aacaagtccatcaatgaagctctaaacgatctgctgattgaagaggaagattataatgga
ctgcgtgcctccatcgacgcctttgacaactttgacaacatcaatctggcgcagcgcctg
gagaagcacgagctgatcgagttccgccgcatcgccgcgtacctgtacaagggcaataac
cgctggcagcagtccgtcgagctgtgcaagagggataaactattcaaggacgccatgatg
tatgccgctgaatcacgcaagaagcagacggccgaagatcttatccattggttcctggag
atcggccataacgagtgcttcgccgcatgtctctttatgtgctacgatcttcttagtccg
gattacgtgctcgagctcgcctggcgccataaacttattgattttgctatgccgtatatc
atacaagtattaaaagaatatatagataaggtcgataaattacgagctcaagaagcggag
cggaaagatcaagaagaaactaagcaagacgcacctatagtattcgataacccacagctg
atgataactgcaggtcctgcttttgctccacctggttttgctggaccacaaggaatgcca
gcaatgcccccccaacaacaaccctacggctttcagccaggatacggcatgtaa

DBGET integrated database retrieval system