KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g163815Help
Entry
NEMVE_v1g163815   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NEMVE_v1g163815
Enzymes [BR:nve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NEMVE_v1g163815
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C44
   NEMVE_v1g163815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 555 aa AA seqDB search
MCGIWAIFGIHDYHKYTTSSMAIKGRGPDCFRMETIPHFSNCCLAFHRLAVVDDLYGMQP
MRIKKLPHLFLIYNGEIYNHKQVEEKFGFDVFTQCDGEVILHLYDKFGAEKAAQMLDGVF
AFCIIDTKKKQVHLGRDTFGIRPMFTLKQEDTKPTVLAICSEAKSLTEIEKTFTGNGHKM
QLETFPPGHYHSYSLGANGQVALLESGPYTYIGKPPVFDTGVVPVRDTMENIRLYMTQAV
KKRLMADRRIGCFLSGGLDSSLVAALLTKEAKNAGIDYPIQTFSIGMEGSPDVAAARKVA
AHIGSEHHEVTFTPEEGIQALHDVIYALESYDITTIRASVPMYLVAKYVSENTDTVVVYS
GEGSDELCQGYIYFHKAPSPEEGDKESLRLLKDLYLYDVLRGDRSTAVHGLEIRVPFLDV
AFTSYFLSLPPAERQPKEGVEKWLLRAAFDGTGLLPHEILWRPKEAFSDGVTSNAPGKSW
FEILQCYVEDHVADEALAKASKLYPFNTPRTKESFYYRSVFEELFPGHHELIPYMWLPQW
TGATDPSARTLSHYK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatctgggctatctttggtattcatgactatcacaagtacacaacatcttca
atggccatcaaagggcgtggccccgactgtttccgtatggagaccataccgcatttcagc
aactgctgcctagctttccatcgcttggctgttgttgatgacttgtacggtatgcagcca
atgaggataaaaaagcttcctcaccttttcctcatctacaacggggagatctacaaccac
aaacaagtagaggagaaatttggctttgatgtgttcacacagtgtgatggggaggtgatt
cttcacctttatgacaagtttggtgcagagaaagcagctcagatgctagatggagtgttt
gcattctgtattatcgataccaagaaaaagcaggttcaccttggtcgagacacatttggt
atcaggcccatgtttaccttgaaacaagaagatacaaaacctactgttcttgccatctgc
tccgaagcaaagtccctaactgagatagagaagacatttacaggaaatggccacaaaatg
cagctggagacatttcctccaggacattatcactcctacagccttggtgctaatggccaa
gtggccctcctagaaagtggtccctacacatacataggcaagccgcctgtctttgacaca
ggtgtggtccccgttagagacactatggaaaatatcaggctgtatatgactcaggccgtt
aaaaaacgattgatggctgacagacgcattggttgctttctctctggtggcctggactct
agcttggtagctgctctactcaccaaggaagcaaagaatgctgggatagactaccccatc
cagacgttctctattggaatggagggaagcccagatgtagctgctgcacgtaaggttgca
gcacacattgggtctgagcatcatgaagtaaccttcaccccagaagaaggtattcaagcc
ctacatgatgtgatatatgctctcgagtcctatgacatcaccactatccgggcgtctgtt
ccgatgtacctggttgctaagtatgtcagtgaaaatacagacactgtggtagtgtactcg
ggcgagggttcagatgagctctgccagggctacatatacttccacaaggccccatctccg
gaggaaggcgacaaagaatctctgcggctgttgaaggatctctacctctatgatgtcctt
cgaggtgaccggagtacagcagtgcatgggcttgagataagagtgccctttcttgatgtc
gccttcacctcctacttcctgtctctaccccctgcagagcgtcagccgaaagaaggggtg
gagaaatggttgttgcgtgctgcatttgatggaactggtctcctccctcatgaaatcctg
tggcggccaaaagaggccttcagtgatggagtcacctctaacgctcctggcaagtcctgg
tttgagattctccaatgttatgtagaagatcatgtagctgatgaggcgcttgcaaaggca
agcaagctatacccattcaatacacctcgcaccaaagagtcattttactatcggtcagta
tttgaggagctgtttcctggtcaccatgagcttatcccatatatgtggctgccacagtgg
actggagcaactgatccgtctgcccgtactctgtctcattacaaatga

DBGET integrated database retrieval system