KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g164353Help
Entry
NEMVE_v1g164353   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nve00001]
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    NEMVE_v1g164353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 5515240
NCBI-ProteinID: XP_001635381
JGI: 164353
UniProt: A7RZ03
AA seq 104 aa AA seqDB search
MGDATKGAKVFKTKCAQCHTVEAGGKHKTGPNLHGLFGRKTGQAEGFSYTTANQNKGITW
GEDTLMVYLENPKKYIPGTKMVFAGIKKKNERLDLIAYLKQETS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcgaccaagggagcaaaggtcttcaagacaaagtgcgcacagtgccacact
gtagaagctggaggcaaacacaagacaggccctaatctccatggtctgtttggccgcaag
acaggccaagccgaaggtttctcatacacaaccgccaatcagaacaaaggaattacatgg
ggagaggatacgctaatggtataccttgagaaccccaagaaatatattccaggaacaaag
atggtatttgctggaataaaaaagaagaatgaaagattagatctgatcgcataccttaaa
caggaaacaagctga

DBGET integrated database retrieval system