KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g164483Help
Entry
NEMVE_v1g164483   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00500  Starch and sucrose metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NEMVE_v1g164483
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NEMVE_v1g164483
Glycosyltransferases [BR:nve01003]
 Polysaccharide
  Storage polysaccharide
   NEMVE_v1g164483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 5515178
NCBI-ProteinID: XP_001635283
JGI: 164483
UniProt: A7RZD4
AA seq 660 aa AA seqDB search
MNNPGVFYQEYEDDPPYFTFEVSWEVANKVGGIYTVIRSKAATSVDIHGDNYCMMGIYNK
AQCNMEVEMTEPDMKAMKGALKCMRNKGVQVHFGRWLIEGYPKVVLFDIGSVYHKLNKWK
ADLWENCHIGLPDGDTEANDSLVLGCLVAQFISEFRSRFDPEIPVVAHFHEWQAGVGEIM
LRTKKVNVSTVFTTHATLLGRYLCAANVDFYNNLERFDVDKEAGDRGIYHRYCLERAAAH
AAHVFTTVSRITADEAEHLLKRKPDLVVPNGLNVVKYTALHEFQNLHAKSKEKINDFVRG
HFYGHFDFDLDKTLYFFAAGRYEYFNKGADVFLESLARLNYQLKTNNSETTVVAFLIFPT
KTNNFNVDSLRGQAVTKQLKETVNEIQDKIGKRIYESCVKGNLPSGESLLEPDDIVRLKR
CVLGAQHPEMPPVVTHNVLNDATDPILCHIRRIQLFNTRHDRVKIVFHPEFLSNINPLLA
MEYSEFVRGCHLGVFPSYYEPWGYTRAECTVMGIPSVTTNLSGFGRFMAEHVCDPTSYGI
YIVDRRFKCAEESIQELSGYMFSFCTMTRRQRIIQRNRTERLSELLDWKSLYRFYARARL
LGLHRLEPAKYEHPNLTDEIRSAFNYPRPPSAPPSPAPSEAGSDKESETEEDEQYRLFSV
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccctggggtgttttaccaagagtatgaagatgatccaccgtacttcacgttt
gaggtgtcttgggaggttgcgaacaaagttggaggaatttacaccgtgatcaggtctaaa
gctgctaccagtgtggatatccatggagataactattgcatgatgggtatctataacaaa
gctcagtgtaatatggaagttgagatgacagagccagacatgaaggcaatgaaaggagca
cttaagtgcatgcgaaacaagggagtacaggtacattttggcaggtggctgattgaaggt
taccctaaggttgttctatttgacattggttcagtgtaccacaagctcaacaagtggaag
gcagacctgtgggaaaattgtcacattggtctccctgatggggacactgaggccaatgac
tcgcttgtgcttggatgtctggtcgcacagtttatttcagagtttcgaagtcgctttgac
cctgaaattccggtcgttgcccattttcacgaatggcaagcaggagttggtgagataatg
ctaaggaccaagaaagtgaatgtatcgacggtgttcaccacccacgccacccttctgggg
cggtacctctgtgctgctaatgttgacttctataacaatctcgaaaggtttgatgtcgat
aaggaggcgggcgaccgtggtatctatcataggtactgcctggagagggctgcggcacat
gctgcacatgtgttcactactgtatcgcgcatcactgccgatgaggccgaacatctgctt
aagagaaaaccagatctggtagtacccaatggcctgaacgtggttaaatacactgctctt
catgagtttcagaacctccatgcaaaatcaaaagaaaagatcaatgactttgtgcgtggt
catttctatggtcactttgactttgatcttgataaaaccctgtatttttttgctgctgga
aggtatgagtattttaacaaaggcgctgatgtgtttttggaatcattagcaagactcaat
taccagcttaagaccaataactcggaaacaacagtcgtagccttcctcatattcccgact
aaaacaaacaacttcaatgtcgactccctccgaggacaagctgttactaagcagctcaaa
gagacggtgaatgagattcaagataagattgggaaacgaatttacgaaagctgtgtcaag
ggtaatcttccgagtggggaatcgctgctggaaccagatgacattgtgaggctcaagcgg
tgtgttctcggtgcccagcaccctgagatgccaccggttgtgacgcataacgtcttaaat
gacgccactgacccgattctgtgccatatccggcggatacaactcttcaatactcgccac
gatcgtgttaagatcgtgttccacccggagttcctgtctaacatcaaccctctgcttgcc
atggagtacagcgagttcgtccgtggatgccatctgggggtgtttccttcttactatgag
ccctggggatatacacgagcggaatgcacggttatgggtatcccttcggtcaccaccaat
ctgtctgggtttgggcggttcatggccgagcacgtgtgtgaccccacctcctacggaatc
tacatcgtggacaggcgctttaaatgcgctgaggaatctatccaggagctcagcgggtac
atgttcagtttttgtaccatgactcgacgccaacgaatcattcaaaggaatcgtacggag
cgactcagcgagctgttggattggaagagtctgtacaggttctacgctcgcgcccgctta
ctagggctgcatcgtctggaaccagcgaagtacgaacacccgaacttgaccgatgaaatc
cggtccgcgttcaactaccccagaccgccatcagccccgccctcccctgcaccatctgag
gcaggatccgataaagaatcagaaacagaggaagacgagcagtacaggttgtttagtgta
tga

DBGET integrated database retrieval system