KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g164483Help
Entry
NEMVE_v1g164483   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NEMVE_v1g164483
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NEMVE_v1g164483
Glycosyltransferases [BR:nve01003]
 Polysaccharide
  Storage polysaccharide
   NEMVE_v1g164483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 660 aa AA seqDB search
MNNPGVFYQEYEDDPPYFTFEVSWEVANKVGGIYTVIRSKAATSVDIHGDNYCMMGIYNK
AQCNMEVEMTEPDMKAMKGALKCMRNKGVQVHFGRWLIEGYPKVVLFDIGSVYHKLNKWK
ADLWENCHIGLPDGDTEANDSLVLGCLVAQFISEFRSRFDPEIPVVAHFHEWQAGVGEIM
LRTKKVNVSTVFTTHATLLGRYLCAANVDFYNNLERFDVDKEAGDRGIYHRYCLERAAAH
AAHVFTTVSRITADEAEHLLKRKPDLVVPNGLNVVKYTALHEFQNLHAKSKEKINDFVRG
HFYGHFDFDLDKTLYFFAAGRYEYFNKGADVFLESLARLNYQLKTNNSETTVVAFLIFPT
KTNNFNVDSLRGQAVTKQLKETVNEIQDKIGKRIYESCVKGNLPSGESLLEPDDIVRLKR
CVLGAQHPEMPPVVTHNVLNDATDPILCHIRRIQLFNTRHDRVKIVFHPEFLSNINPLLA
MEYSEFVRGCHLGVFPSYYEPWGYTRAECTVMGIPSVTTNLSGFGRFMAEHVCDPTSYGI
YIVDRRFKCAEESIQELSGYMFSFCTMTRRQRIIQRNRTERLSELLDWKSLYRFYARARL
LGLHRLEPAKYEHPNLTDEIRSAFNYPRPPSAPPSPAPSEAGSDKESETEEDEQYRLFSV
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccctggggtgttttaccaagagtatgaagatgatccaccgtacttcacgttt
gaggtgtcttgggaggttgcgaacaaagttggaggaatttacaccgtgatcaggtctaaa
gctgctaccagtgtggatatccatggagataactattgcatgatgggtatctataacaaa
gctcagtgtaatatggaagttgagatgacagagccagacatgaaggcaatgaaaggagca
cttaagtgcatgcgaaacaagggagtacaggtacattttggcaggtggctgattgaaggt
taccctaaggttgttctatttgacattggttcagtgtaccacaagctcaacaagtggaag
gcagacctgtgggaaaattgtcacattggtctccctgatggggacactgaggccaatgac
tcgcttgtgcttggatgtctggtcgcacagtttatttcagagtttcgaagtcgctttgac
cctgaaattccggtcgttgcccattttcacgaatggcaagcaggagttggtgagataatg
ctaaggaccaagaaagtgaatgtatcgacggtgttcaccacccacgccacccttctgggg
cggtacctctgtgctgctaatgttgacttctataacaatctcgaaaggtttgatgtcgat
aaggaggcgggcgaccgtggtatctatcataggtactgcctggagagggctgcggcacat
gctgcacatgtgttcactactgtatcgcgcatcactgccgatgaggccgaacatctgctt
aagagaaaaccagatctggtagtacccaatggcctgaacgtggttaaatacactgctctt
catgagtttcagaacctccatgcaaaatcaaaagaaaagatcaatgactttgtgcgtggt
catttctatggtcactttgactttgatcttgataaaaccctgtatttttttgctgctgga
aggtatgagtattttaacaaaggcgctgatgtgtttttggaatcattagcaagactcaat
taccagcttaagaccaataactcggaaacaacagtcgtagccttcctcatattcccgact
aaaacaaacaacttcaatgtcgactccctccgaggacaagctgttactaagcagctcaaa
gagacggtgaatgagattcaagataagattgggaaacgaatttacgaaagctgtgtcaag
ggtaatcttccgagtggggaatcgctgctggaaccagatgacattgtgaggctcaagcgg
tgtgttctcggtgcccagcaccctgagatgccaccggttgtgacgcataacgtcttaaat
gacgccactgacccgattctgtgccatatccggcggatacaactcttcaatactcgccac
gatcgtgttaagatcgtgttccacccggagttcctgtctaacatcaaccctctgcttgcc
atggagtacagcgagttcgtccgtggatgccatctgggggtgtttccttcttactatgag
ccctggggatatacacgagcggaatgcacggttatgggtatcccttcggtcaccaccaat
ctgtctgggtttgggcggttcatggccgagcacgtgtgtgaccccacctcctacggaatc
tacatcgtggacaggcgctttaaatgcgctgaggaatctatccaggagctcagcgggtac
atgttcagtttttgtaccatgactcgacgccaacgaatcattcaaaggaatcgtacggag
cgactcagcgagctgttggattggaagagtctgtacaggttctacgctcgcgcccgctta
ctagggctgcatcgtctggaaccagcgaagtacgaacacccgaacttgaccgatgaaatc
cggtccgcgttcaactaccccagaccgccatcagccccgccctcccctgcaccatctgag
gcaggatccgataaagaatcagaaacagaggaagacgagcagtacaggttgtttagtgta
tga

DBGET integrated database retrieval system