KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g164856Help
Entry
NEMVE_v1g164856   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K13135  
gem associated protein 7
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g164856
Spliceosome [BR:nve03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    NEMVE_v1g164856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 92 aa AA seqDB search
MADEEAKHSSTDEQEIRSFLRERFLKSIQTMYNKPAVFTMHERTEVRAVFRGTDINIENF
AVSELKSPIGLIPEAILRASDVLCFTVKDDVI
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagaagcaaaacatagttctacagatgaacaagaaatacgtagttttctg
cgcgagagatttcttaaatcgatacagacaatgtataacaagcctgcggtattcacgatg
cacgaaagaacagaagttagagcggtattcagaggcactgacatcaacattgagaacttt
gcagtttctgagttgaagtcaccaatcggactaattccagaagctattcttagagcatcg
gatgtcctttgttttaccgtaaaagacgacgtaatctga

DBGET integrated database retrieval system