KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g165393Help
Entry
NEMVE_v1g165393   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NEMVE_v1g165393
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NEMVE_v1g165393
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g165393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 686 aa AA seqDB search
MSVVPELSKFLHDDPYIQPYVQEIERRYKCFKSIKTDIQNHEGGLEPFSRGYEKFGINRT
ASGGQVYREWAPGAHGVFLIGDFNGWNRTSHPCKRNEYGVWELEIPCLDNGSLSIPHGSK
VKVGIQLQSGEIVDRISPWIRYAAPPQDETNTVYEGINWDPPNPYQFKHTRPKRPKSLRV
YEAHVGIASNEPKVASYQHFAEVVIPKVHGLGYNCIQLMAVMEHAYYACFGYQVTSFFAA
SSRYGTPDELRLLIDTAHSYGIVVLLDIVHSHAAKNVMDGLNQFDGTEGCYFHSGGRGTH
SLWDSRLFDYTQWEVLRFLLSNLRWYMDFYQFDGFRFDGVTSMIYHDHGLGHGFGGDYPD
YFGLGVDTQSLIYLMLANEMLHSIYPDVITVAEEVSGLPGLCRPIAEGGTGFDYRLGMAI
PDMWIKVLKSLKDEDWVMGDIVWTLINRRHNEKTIAYAESHDQALVGDKTIAFWLMDKEM
YTNMSDMTPFTPIIDRGIALHKMIRLITMGLGGEAYLNFIGNEFGHPEWLDFPRAGNNIS
YHYARRQWHLVDDELLRYKYLYRFDMAMQHLEAKYGWLSTEQAYVSNKHEDDKIIAFERG
NLLWIFNFHPTKSFPDYRVGVNRAGKFNLVLSTDAEEFGGHRRVDPDCRYYVESRPWHNR
AFSLLVYIPCRCALVLAPDDLQPPTT
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgtccccgaattgtccaagtttcttcatgatgatccatatattcaaccatat
gttcaagaaatagaaagaaggtacaagtgctttaaatcaatcaagacagacatccaaaat
catgaagggggattggagcccttctcccgaggctatgagaagtttggcattaacaggaca
gcctctggtggccaggtgtaccgcgagtgggctcctggtgcacatggggtgttcctaatt
ggtgactttaatggctggaacaggacttcacatccatgcaagaggaatgagtatggagtc
tgggaactagagatcccttgtttagacaacggctctttatctatacctcatggcagcaaa
gtcaaggttggcatccaactgcagtctggtgaaatagtagaccgcatctctccttggatc
cgctatgccgcgcctcctcaagatgaaactaatactgtgtacgaaggaattaactgggac
ccgcccaacccttatcagttcaagcacactcgccctaaaaggcccaaaagtctccgtgtt
tatgaagctcacgttggcattgcatccaatgagcctaaagttgccagctatcagcacttt
gctgaggttgtcattcccaaagtccatggattgggatataattgcatccagctgatggca
gtgatggagcatgcatactatgcttgttttggttaccaagtgaccagcttctttgcagca
tcaagtcgttatggaactccagatgagctacgccttttgattgacactgcacactcgtat
gggatagtagtgctgctagatatagtgcacagtcatgcggccaagaacgtgatggatggg
ttgaaccagtttgatggcacagagggctgttatttccattcgggagggagaggaacccac
tctctttgggacagtagattatttgactacacgcaatgggaagtgctgcgttttctactg
tccaatctcaggtggtacatggatttttaccaatttgatgggttcagattcgatggtgtg
acatcgatgatatatcatgatcatggccttggtcatggctttggtggtgactatccagat
tattttggccttggggtggacacccagtcacttatttaccttatgctagccaatgaaatg
ctgcatagcatatatccagatgtcataactgtggcagaggaggtgtccggcttgcctggc
ttgtgtcgaccaatagctgaggggggaacagggtttgactaccgacttggtatggctata
ccagacatgtggatcaaggtgttgaagagcctcaaagatgaggactgggtcatgggggac
atcgtgtggacgctgatcaaccgtcggcacaatgagaagacgatcgcgtacgctgagagc
catgaccaggcgttggtgggagacaagacaattgccttttggctcatggacaaggagatg
tatactaacatgtccgacatgaccccgttcacgcccatcatagaccgaggaattgcactg
cataaaatgattaggttgatcactatgggtctcggcggagaggcgtatctaaacttcatc
ggtaacgaatttggccaccctgagtggcttgattttccccgcgctggcaacaacatcagc
taccactacgcacggcgccagtggcaccttgttgacgacgaactcctgcgctacaaatac
ttgtacagatttgacatggccatgcagcatttggaggctaagtatggatggctcagcacc
gaacaggcttacgtgagcaataaacatgaagacgacaagataatcgcatttgagagagga
aatttactctggatctttaactttcatcctaccaagagctttcccgactacagagtcgga
gtcaatagggccggaaaattcaacctcgtgctaagtactgacgctgaggagtttggcggc
cacagacgagtagaccctgactgccggtactacgtggagagtagaccttggcacaacagg
gctttttcgcttctggtgtacatcccgtgtagatgcgccttggtgctagccccggacgat
cttcaaccgcctacaacctga

DBGET integrated database retrieval system