KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g166299Help
Entry
NEMVE_v1g166299   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00010  Glycolysis / Gluconeogenesis
nve00051  Fructose and mannose metabolism
nve00562  Inositol phosphate metabolism
nve01100  Metabolic pathways
nve01200  Carbon metabolism
nve01230  Biosynthesis of amino acids
Module
nve_M00002  Glycolysis, core module involving three-carbon compounds
nve_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g166299
   00051 Fructose and mannose metabolism
    NEMVE_v1g166299
   00562 Inositol phosphate metabolism
    NEMVE_v1g166299
Enzymes [BR:nve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NEMVE_v1g166299
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NEMVE_v1g166299
  Exosomal proteins of bladder cancer cells
   NEMVE_v1g166299
  Exosomal proteins of melanoma cells
   NEMVE_v1g166299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5513276
NCBI-ProteinID: XP_001633516
JGI: 166299
UniProt: A7S4D2
AA seq 247 aa AA seqDB search
MGRKFFVGGNWKMNGSLVQIDGILKNLHDSSLSDDTEIVVSPPALYLSYVRKAAKQNIGV
AAQNCYKVASGAFTGEISPAMIKDIGCEWVIIGHSERRNIFGEKDELIGEKVAHALSANV
KVIACIGELLSEREAGKTQEVVFRQIKAIADKISDWSKVVIAYEPVWAIGTGKTATPQQA
QEVHNQLRAWLKENVSVDVAESTRIIYGGSVNAKNCRELAAEGDIDGFLVGGASLKPEFV
QIVNARL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaagttctttgtcggtggaaactggaagatgaacggaagccttgttcaaatc
gatgggatcttgaaaaatctgcacgacagttcgttatcggacgacactgagattgtggta
tccccgcctgcgctatacctgtcatatgtgcgtaaagctgccaagcagaacattggagtt
gccgcgcagaactgttacaaggttgcaagtggtgccttcactggggagatcagcccagct
atgataaaggacatcggatgtgaatgggtgattattggccattcagagagaaggaatata
ttcggagaaaaggatgagctcattggtgagaaggttgcccatgcgctgtccgctaatgtc
aaagtgatcgcttgtattggagagcttctgtcagagcgtgaggctggaaagactcaagaa
gttgttttcaggcagatcaaggctattgcagataagatatctgattggagcaaggttgtg
attgcatatgagccagtctgggccattgggacaggcaagacagccacaccccaacaggca
caagaagtgcataaccaactcagagcatggcttaaggagaatgtgtctgttgatgtggcc
gagtcaacacgcatcatctatggaggttctgtcaatgccaaaaactgccgagagcttgca
gcggaaggtgacattgatggcttccttgtgggcggagcttccctgaagccagagtttgta
caaatcgttaacgccagactatag

DBGET integrated database retrieval system