KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g166945Help
Entry
NEMVE_v1g166945   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 981 aa AA seqDB search
MDQILRGIVASDHPENVKKSLIQQLVSKAASDIPEEQCNALYEMSCQWMAEGNAGFLGEM
GKLLLLSWGKHHKEIFQRFFTETHLINLLESSEKLSPGHINFVRVSFDLLQHTPQIFSLY
TLVRHRVHTVLTQNLSIELGAAVCRLLIEYPHCWPVGERLLQVNVALICALSKTQLPKSS
KSELKSCIQSGGLIGALLNQIWTKNQNLLFPVLTEIFNVISMPGTNPSVALASVVGFFSP
EVITTATRLAASNPAVTDERMALALGRMISWLSWPGGKRVDQWIVSFLRALAMSGKHGVL
INVTLEKLPQVFSRLLFPVVRESTMVVLSHMLLSFQHSPQAFHLIVEHVPDLVKSLRKED
SVSSKACLQTLAELMHCLMYQHSGFPELYSPVLDCLQDMTKPSDAMIRKWLAQSAWSAQA
VQLASPRITSKSETGRTGLVNLGNTCYINSVLQSLYMLEEFRSLVMMKKTVPQCHKVLSQ
LQEVFAFLSLSQRAAFAPSKFLHAARPPWFAPGTQQDCSEFLKYMLDRLEEEDKIQAGVN
RSMSGAGLGQDMISNIIEDTFSGRLIVCHSCRRCRHVSCREEAFTDLPLAFPHQRDAASI
TSSPKPDNPEEAPATDRSLKGGDIGQRPPAASITAPDEEAVASDESSCGATAAYSYPSQV
KSSATGIGASDPSISLEEMLGYFFEPEMLEGSNQYHCERCQGLQDAERSVVIANAPMFLV
LTLKRFSYNVRTHERSKILQSVSYPARLQLSNVCVPPSRRNSDFDSDYGSAGTDDPFQEL
RATIAVENFPSETMYALTSVIVHSGTSSESGHYYCYAIPSGRVSLTKNAPKSVQTTSKRP
QDNLKNFPSPRKTPPGKDSSASANSWYLLNDSRVSYASFESFSDITKRFPKDTPYVLIYK
NISRAPVARVGEQLDGEIRQDLVDAVTRDNLQYLQESERSSSHASRGVSHPPRSDDDGDN
GPSGSCGPGSGFNAPFNRFVF
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaattctgcgaggaattgtcgcttcggatcatcccgaaaatgtgaaaaaatcc
ctgatacagcaacttgtttcaaaggcagccagtgacatcccagaagagcaatgcaacgca
ctttatgagatgagctgtcagtggatggccgaagggaatgcaggatttttaggcgaaatg
ggaaaactgttacttttatcatggggaaaacaccacaaagaaatcttccagaggttcttt
acggaaacacacttaataaatctcttagaatcaagcgaaaaactctctcctggacacatc
aattttgtgcgtgtctcatttgacttgcttcaacacacaccgcaaatcttttccttgtac
actcttgtgagacatcgcgttcacacagtattaacacagaatctaagcatagagttaggc
gcagctgtgtgccggctattgatagaatatcctcattgttggccagtgggggagcgttta
ctacaagttaatgttgctttaatttgtgctctgagcaaaacacaacttcccaaatcttca
aaatcagaattgaagtcatgtatacaaagtggtggacttattggagcattgcttaatcag
atatggacgaagaaccagaatttgttatttccagttttgacagaaatcttcaatgtaata
tctatgccaggaactaacccatcggttgcccttgcctctgttgtgggatttttttcccct
gaggttattacgactgcgacaagacttgctgcctctaatcctgcagtcacagacgagcgt
atggcccttgcactagggcgcatgataagttggctttcctggcctggcggtaaaagggtt
gaccaatggatcgtatcttttctgcgtgctctggcaatgtctggaaaacatggtgtcctc
attaatgtcaccctggaaaaattaccacaagtgtttagccggcttctgtttcctgttgtt
cgtgagagcacaatggttgtgctatctcatatgcttctcagcttccaacactctccccag
gccttccacctgattgttgagcatgtaccggaccttgtgaagagcctaaggaaagaggac
agtgtatcatccaaggcctgtctccagacgctagctgaactaatgcactgcctcatgtac
cagcactctggtttcccagaactgtacagccctgtgcttgactgtttacaagacatgaca
aaaccatcagatgccatgatcaggaaatggctggcacagagtgcgtggtcagcccaagca
gtacagcttgcctcgccacgaatcacttctaagtctgagacaggaagaacaggtcttgtt
aacctggggaacacatgttacatcaacagcgttctacagtcactctacatgcttgaggag
tttcgctcactggtcatgatgaaaaagactgtcccacagtgccacaaggtgctatctcaa
ctccaggaggtgtttgcttttctgagtctgagccaacgggctgcctttgcaccttccaaa
ttccttcatgctgctcgtcccccctggtttgcacctggtacacagcaagactgctctgag
ttcctaaagtatatgctggacagactagaggaggaagacaaaatccaggcgggtgtaaat
aggagcatgtctggtgccggtctggggcaggacatgatttccaatattattgaagatacc
ttcagtgggaggcttattgtttgccacagctgtagacgctgccgccacgtgtcctgccgc
gaagaagcctttacagacctccctctcgccttccctcaccagcgcgacgcggccagcatc
acctcctcgcccaagcctgacaacccagaggaggccccagctaccgacagaagcctcaag
ggcggggacatcggacaacgccctcctgcagcaagcattaccgcaccggacgaggaagca
gtggctagtgatgagagttcatgtggtgctactgctgcgtactcgtatcccagtcaggtc
aagtcttcggctacaggtatcggggctagtgatccttccatatccttagaagaaatgctg
ggatacttctttgagccggagatgctcgagggctccaatcagtatcattgcgagcgttgc
caagggctccaggatgctgagcgtagcgtggtgatcgccaacgcgcccatgtttcttgta
ttgactctaaagaggttctcatataatgtacggacgcacgagcgatcaaagatccttcaa
agcgtttcttaccccgcgaggttacaactgtcgaatgtttgtgttccaccttcgcgacgg
aactctgactttgactcagattatggctctgctggaaccgatgaccctttccaggaattg
cgcgccacaattgctgttgagaattttccttcggagacgatgtatgccctcacgtccgtg
atcgtgcattcgggcacgtcttccgagagtggacactactattgctacgcaataccctcc
ggtcgggtgagcctaacaaagaatgcaccgaaatcggtgcaaacgacctccaaacgacct
caggacaatctcaaaaacttcccctcacctcgaaaaacaccgcctggcaaagactcaagc
gcgagcgcgaactcgtggtatctcttgaacgacagtcgcgtctcgtacgcaagttttgag
tcgttttccgacattactaaacgctttcctaaggacactccctatgtgttaatctacaag
aacatcagtcgcgcgcccgtagcgagagtgggtgagcagctggatggggagatacgccaa
gacttagtggatgctgtaacgcgggataacctacaataccttcaggagagcgagcgttcg
tccagtcacgcaagtcgtggagtctcgcatccgcctcgtagtgacgacgatggggataat
ggtccttctggtagctgcggtcctggctccggttttaatgcgcccttcaatagatttgtt
ttctag

DBGET integrated database retrieval system