KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g167568Help
Entry
NEMVE_v1g167568   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve03022  Basal transcription factors
nve03420  Nucleotide excision repair
Module
nve_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NEMVE_v1g167568
  Replication and repair
   03420 Nucleotide excision repair
    NEMVE_v1g167568
Transcription machinery [BR:nve03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NEMVE_v1g167568
DNA repair and recombination proteins [BR:nve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     NEMVE_v1g167568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 5511895
NCBI-ProteinID: XP_001632226
JGI: 167568
UniProt: A7S801
AA seq 306 aa AA seqDB search
MFHTSTQRKHWIFKNQEEVQKLRENVNSAYKSRHSEAYPDKKNVKYLTVEEEKKLVEYYE
LVIVEVSAKFQPPVPRSVTATAITYLKRFYVKTSVMDHPPKEMFLVCLFMACKVEEYNIS
VENFVQILPRDRREKVMDFILAHELLLMERLDFHLTIHHPFRPMEGFLIDIKMYLSEGKV
NPESWRIKAEEFLLRAMRTDVAFHFSPSQIALAALSVGSTGGELQKYVNEKFGVTDKGTA
LMDTINSIVNMVTSHIVTVTKDQVKALESKLKTCRNPENNPDSKMFKRRTSGNDENQVEQ
MEIESP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttccacactagcactcagagaaagcactggatattcaaaaatcaagaagaagtacaa
aaactgcgtgaaaatgtaaacagcgcgtacaaatctcgccatagcgaggcctatcctgac
aagaaaaacgtaaaatacctgacagttgaagaagaaaagaaactggtggaatactatgag
ctggtcatcgtggaagtatcagctaaattccagccgccagttcctcgttcagttaccgct
accgctattacatacctaaagagattctatgtgaagacatcagtcatggatcacccgccg
aaagaaatgtttctcgtttgcttgttcatggcgtgcaaggttgaagagtacaacatttca
gttgaaaactttgtgcaaattttgcccagagatcgtcgagagaaagtaatggattttatt
ttagcacatgagttgttgttgatggagcgtttggattttcatttgacaatccatcaccct
ttccgtcctatggaggggtttttgattgacattaagatgtatttatcagagggtaaggtt
aatcctgagagttggcgcattaaggcagaggagtttttactacgtgccatgcgcacagat
gtagcatttcacttttccccatcacagatcgcgctagctgcgctctcagttgggagtact
ggtggtgaattacagaagtatgtaaacgagaagtttggagtaactgacaaggggactgct
ctcatggataccattaactcaattgttaacatggttacaagtcacattgttacagttact
aaagaccaggttaaagcattggaaagtaaacttaagacctgccgtaatccagaaaacaat
cctgatagtaagatgttcaagcggagaacatcagggaatgatgaaaaccaagtggaacag
atggaaatagagagtccataa

DBGET integrated database retrieval system