KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g167568Help
Entry
NEMVE_v1g167568   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NEMVE_v1g167568
  Replication and repair
   03420 Nucleotide excision repair
    NEMVE_v1g167568
Transcription machinery [BR:nve03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NEMVE_v1g167568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MFHTSTQRKHWIFKNQEEVQKLRENVNSAYKSRHSEAYPDKKNVKYLTVEEEKKLVEYYE
LVIVEVSAKFQPPVPRSVTATAITYLKRFYVKTSVMDHPPKEMFLVCLFMACKVEEYNIS
VENFVQILPRDRREKVMDFILAHELLLMERLDFHLTIHHPFRPMEGFLIDIKMYLSEGKV
NPESWRIKAEEFLLRAMRTDVAFHFSPSQIALAALSVGSTGGELQKYVNEKFGVTDKGTA
LMDTINSIVNMVTSHIVTVTKDQVKALESKLKTCRNPENNPDSKMFKRRTSGNDENQVEQ
MEIESP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttccacactagcactcagagaaagcactggatattcaaaaatcaagaagaagtacaa
aaactgcgtgaaaatgtaaacagcgcgtacaaatctcgccatagcgaggcctatcctgac
aagaaaaacgtaaaatacctgacagttgaagaagaaaagaaactggtggaatactatgag
ctggtcatcgtggaagtatcagctaaattccagccgccagttcctcgttcagttaccgct
accgctattacatacctaaagagattctatgtgaagacatcagtcatggatcacccgccg
aaagaaatgtttctcgtttgcttgttcatggcgtgcaaggttgaagagtacaacatttca
gttgaaaactttgtgcaaattttgcccagagatcgtcgagagaaagtaatggattttatt
ttagcacatgagttgttgttgatggagcgtttggattttcatttgacaatccatcaccct
ttccgtcctatggaggggtttttgattgacattaagatgtatttatcagagggtaaggtt
aatcctgagagttggcgcattaaggcagaggagtttttactacgtgccatgcgcacagat
gtagcatttcacttttccccatcacagatcgcgctagctgcgctctcagttgggagtact
ggtggtgaattacagaagtatgtaaacgagaagtttggagtaactgacaaggggactgct
ctcatggataccattaactcaattgttaacatggttacaagtcacattgttacagttact
aaagaccaggttaaagcattggaaagtaaacttaagacctgccgtaatccagaaaacaat
cctgatagtaagatgttcaagcggagaacatcagggaatgatgaaaaccaagtggaacag
atggaaatagagagtccataa

DBGET integrated database retrieval system