KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g167568Help
Entry
NEMVE_v1g167568   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:nve03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nve03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MFHTSTQRKHWIFKNQEEVQKLRENVNSAYKSRHSEAYPDKKNVKYLTVEEEKKLVEYYE
LVIVEVSAKFQPPVPRSVTATAITYLKRFYVKTSVMDHPPKEMFLVCLFMACKVEEYNIS
VENFVQILPRDRREKVMDFILAHELLLMERLDFHLTIHHPFRPMEGFLIDIKMYLSEGKV
NPESWRIKAEEFLLRAMRTDVAFHFSPSQIALAALSVGSTGGELQKYVNEKFGVTDKGTA
LMDTINSIVNMVTSHIVTVTKDQVKALESKLKTCRNPENNPDSKMFKRRTSGNDENQVEQ
MEIESP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttccacactagcactcagagaaagcactggatattcaaaaatcaagaagaagtacaa
aaactgcgtgaaaatgtaaacagcgcgtacaaatctcgccatagcgaggcctatcctgac
aagaaaaacgtaaaatacctgacagttgaagaagaaaagaaactggtggaatactatgag
ctggtcatcgtggaagtatcagctaaattccagccgccagttcctcgttcagttaccgct
accgctattacatacctaaagagattctatgtgaagacatcagtcatggatcacccgccg
aaagaaatgtttctcgtttgcttgttcatggcgtgcaaggttgaagagtacaacatttca
gttgaaaactttgtgcaaattttgcccagagatcgtcgagagaaagtaatggattttatt
ttagcacatgagttgttgttgatggagcgtttggattttcatttgacaatccatcaccct
ttccgtcctatggaggggtttttgattgacattaagatgtatttatcagagggtaaggtt
aatcctgagagttggcgcattaaggcagaggagtttttactacgtgccatgcgcacagat
gtagcatttcacttttccccatcacagatcgcgctagctgcgctctcagttgggagtact
ggtggtgaattacagaagtatgtaaacgagaagtttggagtaactgacaaggggactgct
ctcatggataccattaactcaattgttaacatggttacaagtcacattgttacagttact
aaagaccaggttaaagcattggaaagtaaacttaagacctgccgtaatccagaaaacaat
cctgatagtaagatgttcaagcggagaacatcagggaatgatgaaaaccaagtggaacag
atggaaatagagagtccataa

DBGET integrated database retrieval system