KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g167869Help
Entry
NEMVE_v1g167869   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NEMVE_v1g167869
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NEMVE_v1g167869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9 sCache_3_2
Motif
Other DBs
NCBI-GeneID: 5511501
NCBI-ProteinID: XP_001631871
JGI: 167869
UniProt: A7S8X8
AA seq 303 aa AA seqDB search
MDAQTKPLIIGAGLALVVAAIGLVVLLTKGAKKSLVALNPEKKIPFKLVDKKIVSHDTRR
FIFQLQSPDHILGLPVGNHMYLSATIDDKPVIRPYTPVTSDDEKGFFELVIKVYFKNVHP
KFPEGGKMSQYLESLKIGDTVDIRGPAGKLIYKGRGTISIKESIRKPEQLRKAKFLGLIA
GGTGITPMLQIIKAVLKDSGDHTTVSLIFANQTERDILVREELEFLASQNSDQFKLWYTL
DRPPEDWAYSGGFIDEKMLREHMPPAGPDTQILMCGPPPMINFACIPNLKKLGFTADMYF
PFG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccagacgaaacccttgatcattggtgctggcttggcactagttgtcgccgct
attggacttgtggttctccttacaaaaggtgccaagaaatctcttgttgccctgaaccct
gaaaagaagatcccttttaaacttgtggataaaaagattgttagtcatgacaccaggaga
ttcattttccagctccagtccccagaccacatccttgggttgccagttggtaaccatatg
tacctttctgctaccattgatgacaagcccgttatcaggccctacactcctgtcacctcc
gatgatgaaaaaggattctttgaactggtgattaaggtatacttcaaaaatgtgcatcca
aagttcccagaagggggaaagatgtcccagtatttagagtccttgaagattggggataca
gttgacatccgaggcccggctggcaagctgatctacaagggaagagggaccatctccatc
aaagagtctataagaaagccagaacagctccgtaaggccaagtttcttggactgatagcg
ggtggaacaggcatcacccccatgctacagatcataaaagctgtgttaaaagattccgga
gatcatactactgtatctctgatctttgcaaaccagactgagagggacatccttgttagg
gaggagctagagtttcttgcaagtcagaatagcgaccagttcaagctctggtatacactt
gatcgaccacccgaggactgggcgtacagtggtgggttcattgacgagaagatgctgagg
gagcacatgccgcccgctggccctgacactcagatactgatgtgtggcccgccgccgatg
atcaatttcgcttgcatccccaacctcaagaagttgggcttcactgccgacatgtacttc
ccgtttggctag

DBGET integrated database retrieval system