KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g168100Help
Entry
NEMVE_v1g168100   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    NEMVE_v1g168100
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    NEMVE_v1g168100
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g168100
  Exosomal proteins of colorectal cancer cells
   NEMVE_v1g168100
  Exosomal proteins of bladder cancer cells
   NEMVE_v1g168100
Heparan sulfate/heparin binding proteins [BR:nve00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  NEMVE_v1g168100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 739 aa AA seqDB search
MNSQSNAFHYVRTFLEKGGACRAGSLPASKPIIAVGVSGDPVNGNNPSPVIANGGGSPQK
CAQKPCFPYVKCTETPGQGLGFRCGPCPPGFSGNGIRCTDVNECDLFPCSSLTTCTNLKP
GYRCSECPRGFHGNATLGLGTEFAKKHKQVCKDIDECSDGKNGGCSIYSECINTPGSFRC
GPCRPGYQGDPYRECTPILFCSGGPKSNPCGKKATCIPRNKGKSYDCECDPGYAGDGKVC
GIDSDMDGFPDNQLSCKGPNCQRDNCRYRPNTGQEDNDGDGIGDACEYDADGDGLPNDVD
NCPRVPNPDQANSDSDQIGDACDNCPTISNPDQKDTDGDGMGDLCDVDIDGDGIINVLDN
CPLVSNRDQKNTDGDPLGDACDNCINARNPTQADRDGDGIGDACDYNEDTDRDGIDDRHD
NCPGKPNSAQLDTDGDGRGDACDDDDDNDGIPDYRDNCRLVPNSDQRDTDLDGIGDACQG
DQDNDGVPDVNDTCPFNPKIHKTDFSQYKNIKLDPLSTKQDQPQWRASQRGDEVFQILNS
NVGLLVGKYLYEDVEYKGTMFVNTNHDDDIIGFAFGYQDYSTFFLVSWKKKEQVYWDVKP
FRATAETHITLKKIKSTTGPSKALRNALWHSGDTTQQVLVLWKSKNQRGWRHRVAYRWEI
TYTPSNGYLRVRMWDGRHIIMDTGRLRDLDIRGGRLGMFSFSQESIVWSALSVHCLGESQ
TQSVKQYMSQNPCYATHVT
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccagtccaacgcgttccattacgtccgcacgttccttgagaaaggaggagca
tgtcgtgcgggctcacttcccgctagtaaacccatcatcgccgtcggggtcagcggcgac
cctgtcaatggaaacaacccaagtcctgtgatagcgaacggcggaggcagccctcagaaa
tgcgcccaaaagccgtgcttcccttacgtgaaatgcactgagacgcccggtcagggcctc
gggtttcgatgtgggccttgccctcccggattctctggaaatggtattcggtgtactgat
gtgaacgagtgtgatctcttcccatgttcttctctcaccacttgtacaaacctcaagccc
ggctatagatgctccgagtgtcctagaggtttccatggcaacgcaactcttggacttggg
acggagtttgccaagaaacacaaacaggtctgcaaggatattgacgaatgcagcgatggt
aaaaacggcggttgctcaatctactcagaatgtattaacactccgggcagtttccgttgc
gggccgtgcaggcctggctaccaaggtgacccatatagagaatgcacgcctattcttttc
tgctctgggggaccaaagtctaatccctgtggcaagaaagcaacttgtattccgagaaac
aaaggaaaaagctacgattgcgagtgcgatccgggatacgctggtgatggcaaggtgtgc
ggtattgatagcgacatggacgggtttccggacaaccagctctcgtgtaaaggaccaaat
tgccagcgtgataactgcagataccgccctaacacaggacaagaggacaatgatggtgat
gggattggagacgcctgtgaatatgacgccgatggggacggtcttccaaacgatgtggac
aactgtccacgtgtaccaaacccggatcaagccaactccgactcggaccagatcggggac
gcgtgcgacaattgcccaaccatcagtaaccccgatcagaaggatacagatggagacggg
atgggcgacctgtgtgacgtcgacatcgacggcgatggaattatcaacgtattggacaac
tgtcccttggtgtctaacagagaccagaaaaacacggatggggacccactaggcgatgcc
tgcgacaactgcatcaacgccagaaaccctacacaggccgaccgtgatggtgacggcatt
ggtgatgcttgtgactacaacgaagacacggaccgtgacggcatagacgataggcatgat
aactgcccagggaaaccaaacagcgcacaactagacacggacggggacggcagaggtgat
gcgtgcgatgatgatgatgacaacgatggcattcccgattaccgcgacaactgccggctc
gtaccaaacagtgaccaaagggatacggacctggacggcatcggtgatgcttgccagggt
gaccaagacaatgacggtgtaccagacgtgaatgacacgtgtccctttaacccgaagatt
cacaagacagactttagccagtacaaaaacatcaagttggaccccctcagcacaaagcaa
gaccaaccacaatggcgggcaagccaacggggtgatgaggttttccaaattctgaacagc
aatgttggactcctcgttggtaagtatttgtacgaagacgtggagtacaaaggcaccatg
ttcgtcaacacaaaccacgacgacgacatcattggattcgcttttgggtaccaggattac
agcacattcttcctggtttcctggaaaaagaaggagcaggtctactgggacgtaaaacca
ttcagagcgacagccgaaactcacatcacccttaagaaaataaaatcaactacaggccca
tcgaaagctctaagaaatgctctatggcacagtggagatacaacacaacaggtgcttgtt
ctatggaagagtaaaaatcaaagaggctggagacatcgagttgcttatagatgggaaatc
acttacaccccttctaatggatatttaagagttcgcatgtgggatggaaggcacattatc
atggacactggtcggttacgggacctggatatccggggtgggaggctagggatgttcagc
ttttcacaagagagcattgtttggagtgctttgtctgtgcactgtttaggtgagtcccag
acacaaagtgtcaagcaatatatgtcacaaaacccatgttatgcaacacatgtcacataa

DBGET integrated database retrieval system