KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g168258Help
Entry
NEMVE_v1g168258   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NEMVE_v1g168258
Transfer RNA biogenesis [BR:nve03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    NEMVE_v1g168258
Chromosome [BR:nve03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    NEMVE_v1g168258
   HAT complexes
    Elongator complex
     NEMVE_v1g168258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47
Motif
Other DBs
NCBI-GeneID: 5511066
NCBI-ProteinID: XP_001631477
JGI: 168258
UniProt: A7SA82
AA seq 549 aa AA seqDB search
MGKKNKKEPVASRAELMVMTVSDIVNQLITAHEKGENINLNKVKGKAASKYGLASQPRLV
DIIAAIPHSHRKVLLPKLKAKPVRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYNPYLQTKHRVEQLKQLGHSVDKVEFIVMGGTFMCLD
EGYRDFFIRNLHDALSGHTSNNVEEAVKYSERSKTKCIGITIETRPDYCLKKHLSSMLAY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHQSKDAGFKVVSHMMPDLPNVGLERDI
DQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPNTLVDLIARILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPF
EIEQIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSDQSFRPELKDRCSIVRELHVY
GSVVPVSARDPSKFQHQGFGMLLMEEAERIAREEHGSIKIAVISGVGTRNYYRKLGYELE
GPYMVKSLI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagaacaagaaagaaccagtggcttctagagcagagttgatggtgatgact
gtctctgacattgtgaaccaactgattactgctcatgagaagggtgaaaacattaacctc
aacaaagtgaaaggtaaagcagcgagtaagtatggcctggccagtcagccacgccttgtg
gatatcattgcagcaatcccccattcacatcgcaaggttcttctcccaaagctgaaagca
aaacctgttagaacagcttctgggattgctgtggttgctgtcatgtgtaagccgcatcga
tgcccacacataaacatgactgggaatatttgtgtgtactgccctggaggacctgattct
gactttgaatactctacacagtcttacactggttatgagccaacatctatgagggcaata
cgtgccagatataacccatacctacagacgaagcacagagtagagcagctgaagcagtta
ggccacagtgtcgacaaggtggagtttattgtaatgggtgggacattcatgtgtcttgac
gagggttacagggattttttcatccgcaacctccatgacgctctgtctgggcacacaagc
aataacgtggaggaggcggtcaagtattcagagcgcagtaagaccaagtgcattggtatc
accatagaaactcgtccagactactgcctcaagaaacacctaagttccatgctggcatat
ggctgcactaggctggagattggggttcagagtgtctatgaagacgttgctcgtgacaca
aacagaggtcacactgtacgtgcagtttgtgagtcttttcatcaatctaaagatgctgga
ttcaaggttgtttcccatatgatgccagacctgcctaatgttggtctagaaagagatatt
gaccaattcatagagttttttgagaacccagctttccgtgcagatgggcttaagatctat
ccaacgcttgtaatacgaggaacaggtctttatgagctgtggaagacagggcggtacaag
agttacccgccaaacacattggtagatctaattgctcgtattcttgcactcgtcccgccc
tggaccagagtctaccgagtacaaagagacatccccatgcctctagttagctctggagtt
gagcatggcaacctgagagaactggcactagctcggatgaaggaccttggtacacagtgt
cgtgatgtcaggacaagggaggttgggattcaggagattcaccacaaagtcaggccattc
gagatcgagcagattcgtcgtgattatgtggctaatggtggatgggagacttttctgtcg
tatgaagatccagaacaagatatcttgatcggccttcttcgactgcgcaagtgttccgat
cagtcgttccgccccgagctcaaagaccgctgctctatcgttcgtgagctgcacgtgtac
ggcagtgtggttcccgttagtgcacgtgatccgtcgaagttccagcatcagggttttggg
atgttgcttatggaggaagcggagcgcatcgcacgagaggagcacggctcaatcaaaata
gccgtcatatctggtgttggtactcgaaattactaccgtaagctagggtacgaactggaa
gggccatatatggtaaaaagtctgatctaa

DBGET integrated database retrieval system