KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g168875Help
Entry
NEMVE_v1g168875   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00264  
glutamate synthase (NADPH/NADH) [EC:1.4.1.13 1.4.1.14]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NEMVE_v1g168875
  Energy metabolism
   00910 Nitrogen metabolism
    NEMVE_v1g168875
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NEMVE_v1g168875
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     NEMVE_v1g168875
    1.4.1.14  glutamate synthase (NADH)
     NEMVE_v1g168875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1791 aa AA seqDB search
MQAREGDMYSEYFGQQTARLFPVVEDGQTDSGRADNILELLVMAGERSLPEAVMMMVPEA
WQNDHLMSTEKKNFYRWSSCSLEPWDGPALFTFSDGRYVGAILDRNGLRPSRYYITEDGH
MIMASEVGVHNFRDEEIVSKGRLRPGRILLVDTKKGIVINDEELKRQISCQYPVGEWLGK
GLYTLEDLHKGDHMTLPSIQSFERVQCLEQDRRLPLFGYSVEDLTMLIVPMIRDKKEALG
SMGNDAALACISTHPQLLFDYFKQLFAQVTNPPIDPIREAIVMSLACPIGPESNLLKPNP
ESCKRLYLDHPVLSCGDLEVIRNCALPQWKSKTLEMVYPVDEGVMSLVPALDRLCDEASK
AVKEGCAFVILSDRSAGISHVPISSLLALGCIHHFLIRTKQRRKIGIIVESAEIREIHHI
CLLLGFGVDAVCPYLLFETMVNLREQNLLSKPLTDKEIVANYIEAARKGISKVMAKMGIS
TLHSYKGAQIFEAVGLSQEVVDKCFVGTASRLGGVSFDILAQEALDRHSIAYADRECDNW
LINNKGLYHWRDGGEKHVNDPRSISYLQDAVKQNNKTAYEKYVHSTVEMVKACTLRGQLD
FKFAHAPLDLSEVEPAAEIVKRFVTGAMSFGSVSIETHKTLAKAMNKLGGKSNTGEGGED
ANRGMGDDNSRSAIRQIASGRFGVDATYLANAVELQIKMAQGAKPGEGGELPGFKVTTEI
AKTRKSVPGVGLISPPPHHDIYSIEDLAELIYNLKCSNPEARISVKLVSEVGVGVIASGV
TKGHAEHIVISGHDGGTGASTWSGIKHAGLPWELGLSETHQTLVLNDLRRRVVLQVDGQM
RTGRDVMVAALLGADEFGFSTAPLIAMGCTMMRKCHLNTCPVGIATQDPVLRKKFEGKPE
HVINFFFMLAEEVRSLLAKLGCRRMSDVIGRCDLLGPSQAQNRKTQLLDFSGLLTTSNEL
RPGDHSAGTEAQDHKLEERKDNELIAAAQGVLNGTVPRVYLEVDIINSDRALGTTLSYHV
AKRYGEDGLPDDSIHVKVNGSAGQSFGAFVAKGITLELEGDANDYVGKGLSGGILIVYPS
RKHGSQFKAEENVIVGNTCLYGATSGKAYIRGVSAERFAVRNSGVTAVCEGVGDHGCEYM
TGGVVVVLGECGRNFAAGMSGGMAFILDRERTFKSFCNHGSVDLEYVTGNDVELLRSLLQ
DHLKSTGSAVAATLLGNWNDSVNLFTKVLKKRGKTCFNLPISLKKKIGDSEKKERSPSRK
NNKNDSPIVDIEEAIPDAEMEQKIIDRVLDKTRGFVKYERSTNHYRPAQQRVKDWKEIYN
HKRSDRNLKVQAARCMDCGVPFCQSHAGCPLGNIIPKWNDLVFQDKWQGALERLLQTNSF
PEFTGRVCPAPCEGACVLAINAKAVTIKKIECTIIDHAFEQGWIKPQIPMTRTGKKVAII
GSGPAGLSAAVQLNKAGHKVTVYEKNDRCGGLLMYGIPSMKLDKKIVQRRLNLMEQEGIT
FVTKSEVGRDVTANQLMADNDAVLMAVGSTWPRDLPIPGRSLEGVHFAMNFLETSQKRQM
GDYSLPSLDATGKHVIVIGGGDTGVDCIATSVRQDAKSIVTFELLAESPESRSPNNPWPT
WPRVFRVEYGHEEVAIKYGRDPRIYNIMSKEFLSNDKGHVRAIKAVEIKWVKDPSGRWVI
EEVPNSEHEFPADLVLIALGFVGPEKSLAKQFGAKVDPRGNFATKRGEYQTSVEKLYTAG
DCHYGQSLVVTAMAEGRQAAREIDLALMGTTSLAGPGGQIHTTRPPPKMTE
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgcgtgagggggacatgtacagcgagtattttggacaacaaaccgcacgttta
ttccctgttgtggaggacggacaaacagattcaggtcgagcggataatatactagagctg
ctggtaatggcaggggaaagatctttgccagaggcggtgatgatgatggtacccgaggcc
tggcagaatgatcatcttatgagcacggaaaagaagaacttttaccgctggagctcctgt
tcactagagccctgggacggcccagctctattcacattctctgatggtcgttacgttggc
gccatcttggaccgcaatggactcaggccctcacggtattacatcactgaagacggtcac
atgatcatggcaagcgaggtcggtgtgcacaactttagggacgaggagatcgtttccaag
ggtcgtttgcgccccggtcgtatacttctcgtcgataccaagaaaggaattgtcatcaac
gacgaggagctcaagagacagatttcatgccaatatcccgtgggggagtggctagggaag
ggattgtacacgctcgaggacctacacaagggagatcacatgaccctaccctcgatccag
agctttgagcgggtccagtgtcttgagcaagaccgacggctgccgctcttcggttattct
gtggaggacctgacaatgctaatagtacccatgatacgggacaagaaagaagcgttaggg
tccatgggtaatgatgcagctcttgcatgcattagtacacatccccagctccttttcgac
tacttcaagcagctgtttgcacaggtgaccaacccaccgattgacccaatcagagaggcg
atcgtcatgtcgctggcgtgccctattggtccagagagcaacctgcttaaaccaaaccct
gaaagctgcaaacgtctctatctcgaccaccccgtgttgtcttgcggagacctggaagtc
attcggaactgtgcactgccccagtggaagagtaaaacactggaaatggtctaccctgtg
gacgagggagtcatgagcctggtgcccgctcttgacaggctatgtgacgaggcatctaag
gctgttaaagagggctgcgccttcgttattttgagtgataggtcagcggggatctcacat
gttcctatcagctcgcttctggcattaggctgcattcatcactttctcatccggaccaag
cagagacgaaagatcggaattatcgtggagtctgcagagatacgagagatccatcacatc
tgcttgcttttgggctttggagtggatgccgtgtgtccgtacttgctctttgaaacaatg
gtcaacttgcgtgaacaaaacttactgtcgaaaccgttgaccgacaaagaaatcgtagca
aactacattgaggccgcgcgtaaaggcatctctaaagtcatggcgaagatgggcatttcc
acactgcacagctataagggagctcaaatctttgaggcagttgggctttcccaagaggtt
gttgacaaatgttttgtgggaacggcatccaggctcggtggggtgtcattcgatatactc
gctcaggaagcacttgatagacacagcatcgcatatgccgaccgagagtgcgacaactgg
ctcattaacaacaagggtttgtaccattggcgtgacggtggcgagaaacacgtgaacgac
ccgagaagcatttcatatctacaggatgccgtgaagcaaaacaacaaaactgcttacgaa
aaatacgtgcattccaccgtcgaaatggtaaaggcctgcactctccgtggtcagctggat
ttcaagttcgcgcatgcgccattagacttgtccgaagtagagcccgcggccgagattgtc
aagcggtttgtcacaggcgcgatgagttttggctccgtctccatcgaaacccacaagacc
cttgcgaaagcaatgaacaaactcggcggcaaaagtaacacaggggaggggggtgaggat
gccaacagggggatgggagatgacaacagtcgatcagccattcgacagattgcatccggg
agattcggcgtggacgccacataccttgcgaacgcggttgaacttcagattaagatggcg
cagggagcaaaaccaggtgaaggtggggaacttccgggattcaaggtcacgactgagatc
gcaaagacacggaagtctgtcccgggagttggtctgatcagccctccaccacatcacgat
atctactccatcgaggatctggcggagttgatctataacctgaagtgctcaaatcctgaa
gctcgaatcagcgtgaagcttgtgtcagaagtcggagtcggcgtcatcgcctcaggcgtc
accaagggccacgcggagcacatagtaatttccggacacgacggtggtactggagcgagc
acgtggtctgggatcaagcacgccgggttgccatgggaactgggactctccgagacccac
cagacgctggtcttgaacgatctccgccggcgagtcgtgctacaggttgacggccagatg
cgcaccggacgtgacgtcatggtggcggcgttgctaggtgccgacgagttcgggttctcc
accgctccactaatcgccatgggttgtaccatgatgcgcaagtgccaccttaacacgtgt
ccggttggcatagcaacgcaggatccagtcctacgcaagaaattcgaaggcaagccagaa
cacgtgatcaacttctttttcatgctcgctgaagaggtgcgatcgctgcttgcaaagctc
ggttgtcgtcgcatgagtgacgtcatcggacgttgtgacttgcttggcccgagtcaagcg
cagaaccgaaagacacagcttcttgacttcagcggccttttgacgacgagtaatgagtta
aggcctggtgaccactctgccggtacagaagctcaagatcacaagctggaagaaagaaag
gacaatgagctgatcgcggctgcgcaaggtgtgctgaacgggacagtcccgcgggtttac
ctcgaagtcgacatcatcaactccgacagggccctgggcactacacttagctatcacgtg
gccaagcgatatggtgaagacggtttgccagacgactcgattcatgtcaaagtcaacggt
tccgcaggccagagttttggcgcgtttgttgccaagggaatcacgctcgaactagaagga
gacgctaatgactacgtcggcaagggactctctggtgggatactcatagtgtaccccagt
cgtaaacacggctcgcagttcaaagcagaggaaaacgtcatcgtgggtaacacgtgcctc
tacggggctacatccgggaaggcatacatccggggtgtttctgccgagcggttcgctgta
aggaactctggcgtgacggctgtatgcgagggtgttggtgaccacggatgtgagtacatg
accgggggcgtggtcgtggttctgggggagtgtggtcggaatttcgcagctgggatgtcc
ggcggaatggctttcatcttggacagggagagaacgttcaagtccttctgcaatcacggc
agtgttgatctagaatacgttaccggaaatgacgtggagcttttacgaagtttactgcaa
gatcacttgaagtccaccgggtctgctgttgctgcgactcttctagggaactggaacgac
tcagtaaaccttttcaccaaggtactaaaaaaacggggaaaaacatgctttaatctccct
atttctctcaagaaaaaaattggcgacagcgagaagaaagagcgctctccgtcgcgaaaa
aacaacaaaaatgatagtccaatagtcgacatcgaggaagccattccagatgcagaaatg
gagcaaaagatcatcgaccgtgtgctggacaaaacccgtggcttcgtgaagtacgaacgt
agcacgaaccattatcgaccagcccagcagcgggtaaaggattggaaggagatctataac
cacaagcggagtgacaggaaccttaaagtacaggcggcgagatgtatggactgcggagtg
cccttctgtcagtcccacgcggggtgtcccctggggaacattatcccgaagtggaacgat
ctcgtctttcaggacaagtggcaaggagctctcgaacgactcttgcaaaccaacagcttc
ccagaattcaccgggagagtgtgtcctgcgccgtgtgagggagcatgcgtactagcaatt
aacgcaaaggccgtgaccatcaagaaaatcgagtgcacgattatcgaccacgcctttgag
cagggctggatcaaaccacagatcccaatgacacggacaggtaaaaaagtcgccattatc
ggaagtggcccagcaggcctttcggccgcagtccagctgaacaaggctggccataaggtc
acagtatacgagaagaatgaccgctgtggcgggctgctgatgtatgggattccctccatg
aaactcgataagaagatcgtgcagcggcgattaaatctgatggagcaagaaggcatcacg
tttgtcacgaaatctgaagtgggccgtgacgtcacagccaatcagctgatggccgataat
gacgctgtcctgatggccgtgggctcaacctggcccagggatctgccaatacccggtcgc
agcctcgaaggtgttcacttcgctatgaattttctcgagacaagtcagaagagacagatg
ggcgactactctctgccatccctggacgcgacaggaaaacacgtgatcgttattggaggt
ggagacactggcgtggattgtatagcgacttctgtgagacaggatgccaaaagcatcgta
acgtttgagctgcttgcggagtcgcctgagtcccgctcacccaacaatccctggccgacc
tggccgcgagtttttcgcgtggagtacgggcacgaggaggttgctatcaagtatggacgt
gaccccagaatatacaacatcatgagcaaggagttccttagcaacgataaaggacacgtc
agagcgatcaaagccgtggagatcaaatgggtcaaggacccgagtggccgatgggttatc
gaggaggttccgaacagcgaacacgaattcccggcagatctcgtgctcattgcgctcggc
ttcgtgggtcccgagaagtcactagcgaagcagttcggagcaaaagtggacccccgcggt
aattttgcgacgaaaagaggcgagtaccagacgagcgtggaaaagctttacacggcagga
gactgccactacggacaatccttggtggtgaccgccatggccgagggccgacaagcagca
cgggaaatcgaccttgccctcatgggaaccacgtccctggcaggaccggggggacaaata
cacaccacaagacctccccccaagatgacagaatag

DBGET integrated database retrieval system