KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g171543Help
Entry
NEMVE_v1g171543   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NEMVE_v1g171543
Enzymes [BR:nve01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NEMVE_v1g171543
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g171543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 321 aa AA seqDB search
MSFSFGAALKSGFQHAVTRQWQSTNTSLTPHNLIYPLFISDDPDGLEHIASLPGQARVGI
NNLEKVVKPLVDKGLSSVLVFGVISKLEKDGNASNADSDLCPTILGIKKLHSLFPDLLII
CDVCLCPFTDHGHCEVMFTGNKIYSSESCDRTANVSKFSAFVGCHVVAPSDMMDNRVAAI
KQIMAANGYGSKVAVLSYSAKFASSFYGPFRDAAKSAPAFGDRRCYQLPPGARGLAMRAV
DRDVQEGADMLMVKPGMPYLDIVRDTKNKYPDLPLAIYQILAANGYASKVAVLSYRQFLF
LLGADIIITYFVPQLLDWLQE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctcatttggcgcagcgctcaaaagtggctttcaacacgccgtgacgcgacaa
tggcaatccacaaacaccagcctgactcctcataaccttatctacccattatttatatcg
gacgaccctgatggcctggagcatattgctagtttgcctggacaagctagagttggtatc
aacaatttggaaaaagttgtaaaacctttggtggacaagggcttatcaagtgttctagtg
tttggtgtcatatcgaaacttgagaaggacggtaatgcatccaatgctgactctgatttg
tgccctacaatccttgggataaagaaactgcattcacttttcccagatctattgataatt
tgtgatgtttgtctttgtccatttactgaccatgggcactgtgaggtgatgtttaccgga
aacaagatttatagttcagagtcatgtgatagaactgcaaatgtttcgaagttctctgcc
tttgtaggctgtcatgttgttgctccgtctgacatgatggataacagagttgctgccatc
aagcagatcatggcggcgaatggttatggcagcaaagtggctgttctgagttatagtgca
aagtttgcctcaagcttttatggacctttcagggacgctgctaagagcgcccctgcattt
ggtgatcgtcgctgttatcagcttccccctggagctagaggcctagccatgagagctgtg
gatcgtgatgtccaggaaggagccgacatgttgatggtgaaaccaggaatgccgtacctg
gatatcgtacgagatacaaaaaacaagtatccagacctaccattggctatataccagatc
ctggcggcgaatggttatgccagcaaagtggctgttctgagttatagacaatttcttttt
cttctaggtgctgacatcatcatcacatactttgtgcctcagcttcttgattggttacaa
gagtaa

DBGET integrated database retrieval system