KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g171912Help
Entry
NEMVE_v1g171912   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nve00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 555 aa AA seqDB search
MRTRICLHLLSLFPFLFSVCSLAEQDVVITLEQGKIQGMREPVPGGYEVEIFLGIPYARA
PVGELRFADPQPPLEWTGIRDAKSYRAVCPQAPFLPNFQPLTENDTISEDCLFLNVYRPT
KFNHKLPVMVWIHGGGYYHATANWFDGSVLASHNNVIVVTINYRLALLGFLHIPGTQLRG
NYGMLDQVQALKWVQQNIASFGGNPSHVTLFGESSGAASVTLHILSPLSAGLFQTAIIES
GSAVSPFGAYSPRASNHYDVFIERLGCFDKENLLNCLREKPFEDFERAVGGVDPRMPGPM
FPVPTVDKVFLPDEPEALLLAGRFNKIESVIIGFNKDEGTFLYSSAEPVTYAPPSIGAFH
KAVHEVTLTQNGDDCELLKQAAIHRYTNHSDPSNPWNLWENWKNLMGDTFFFAPVTRTAN
SLAKAGISTYMYLFTHRSTFSMFPPETGVCHFVEVQYVFGSPWKPNPKIGLTSGYTEVER
GLSSFLMKLWTDFAKNRDPNETVTWPLYSAERQKYLEIDLVTRVRRMPHADRVAFWNKFV
PKLKQYCQGRGETPL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccagaatatgtctccatttactatcactctttccttttctatttagcgtctgt
tcgctggcagagcaggatgtagttataaccctagagcagggtaagattcaaggaatgcgc
gaacctgttccgggtgggtacgaagttgaaatatttctaggaataccttatgcccgcgct
ccggttggcgagttgaggtttgcagatcctcagcctccactagaatggacaggaatacgt
gatgcgaagtcttatagagctgtttgcccacaagcaccatttctaccgaattttcaaccg
ctcacagaaaacgataccatttctgaggactgcctcttcctcaacgtctaccgcccgacc
aaattcaaccacaagctacccgttatggtctggatacacggtggcggttactaccacgcg
accgctaattggttcgacggttccgtgctcgcgtcacataataacgtcatcgtcgttacg
attaattaccgcctagccctgttgggcttcctgcatatccctggaactcagctccgaggg
aattatgggatgctagatcaagtgcaggcgctgaagtgggtccagcaaaacattgcaagt
tttggtgggaatccttcccacgtgaccttatttggtgagagctctggcgcagcgagcgtt
acgctgcatattttgtcgccgctctccgcgggattgtttcagaccgcaatcatagagagc
ggttcagcggtctctccctttggcgcatactcccctcgggccagcaaccactatgacgta
tttatcgaaagactgggttgctttgataaagagaacctgctaaattgtcttagagagaaa
ccctttgaggattttgagcgtgctgtagggggtgtggaccctcgaatgcccggacccatg
ttccctgtcccaacagtggataaggtatttctacccgacgaacctgaagcgttacttctc
gcaggacgattcaacaagatcgaatcagttatcattggattcaacaaagacgagggcact
ttcttatactcttcagcggagcccgtgacctacgcacctccgtctattggcgccttccac
aaagccgtccatgaagtcaccctcacccagaacggcgacgactgcgaacttctcaagcag
gcggctatacatagatacactaaccacagcgaccccagcaatccatggaacttgtgggag
aactggaaaaacctcatgggagatacgttcttctttgcgccggtcacgcgaacagcgaac
agcttggcaaaagcggggatctcgacgtatatgtacctttttactcaccgctcgacgttt
tcgatgtttccgcctgaaacaggtgtttgtcactttgttgaggtgcagtacgtgtttggg
tcgccatggaaaccgaaccccaagattggtctcacatccgggtacacggaggtcgagagg
ggattgagctcgtttctgatgaagctctggacagacttcgcaaagaacagagacccaaac
gaaaccgtaacctggcccctatactcggccgagcgacagaagtacctcgaaatagacctg
gttactagagttcgcaggatgccacacgccgatcgggttgcgttctggaacaagtttgta
cctaagctaaagcagtactgtcaggggaggggtgaaactcccctgtaa

DBGET integrated database retrieval system